Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
57104
Gene name Gene Name - the full gene name approved by the HGNC.
Patatin like domain 2, triacylglycerol lipase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PNPLA2
Synonyms (NCBI Gene) Gene synonyms aliases
1110001C14Rik, ATGL, FP17548, PEDF-R, TTS-2.2, TTS2, iPLA2zeta
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p15.5
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an enzyme which catalyzes the first step in the hydrolysis of triglycerides in adipose tissue. Mutations in this gene are associated with neutral lipid storage disease with myopathy. [provided by RefSeq, Jul 2010]
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121918259 C>T Pathogenic Coding sequence variant, missense variant
rs192598547 C>T Conflicting-interpretations-of-pathogenicity Coding sequence variant, synonymous variant
rs554737718 G>A,C Pathogenic Missense variant, coding sequence variant
rs796065307 C>- Pathogenic Frameshift variant, coding sequence variant
rs796065308 ->C Pathogenic Frameshift variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019467 hsa-miR-148b-3p Microarray 17612493
MIRT023204 hsa-miR-124-3p Microarray 18668037
MIRT023204 hsa-miR-124-3p PAR-CLIP 26701625
MIRT023204 hsa-miR-124-3p PAR-CLIP 26701625
MIRT023204 hsa-miR-124-3p PAR-CLIP 26701625
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004806 Function Triglyceride lipase activity EXP 17603008
GO:0004806 Function Triglyceride lipase activity IBA 21873635
GO:0004806 Function Triglyceride lipase activity ISS
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609059 30802 ENSG00000177666
Protein
UniProt ID Q96AD5
Protein name Patatin-like phospholipase domain-containing protein 2 (EC 3.1.1.3) (Adipose triglyceride lipase) (Calcium-independent phospholipase A2-zeta) (iPLA2-zeta) (EC 3.1.1.4) (Desnutrin) (Pigment epithelium-derived factor receptor) (PEDF-R) (TTS2.2) (Transport-s
Protein function Catalyzes the initial step in triglyceride hydrolysis in adipocyte and non-adipocyte lipid droplets (PubMed:15364929, PubMed:15550674, PubMed:16150821, PubMed:16239926, PubMed:17603008, PubMed:34903883). Exhibits a strong preference for the hydr
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01734 Patatin 10 178 Patatin-like phospholipase Family
Tissue specificity TISSUE SPECIFICITY: Highest expression in adipose tissue. Also detected in heart, skeletal muscle, and portions of the gastrointestinal tract. Detected in normal retina and retinoblastoma cells. Detected in retinal pigment epithelium and, at lower intensi
Sequence
MFPREKTWNISFAGCGFLGVYYVGVASCLREHAPFLVANATHIYGASAGALTATALVTGV
CLGEAGAKFIEVSKEARKRFLGPLHPSFNLVKIIRSFLLKVLPADSHEHASGRLGISLTR
VSDGENVIISHFNSKDELIQANVCSGFIPVYCGLIPPSLQGVRYVDGGISDNLPLYEL
KN
TITVSPFSGESDICPQDSSTNIHELRVTNTSIQFNLRNLYRLSKALFPPEPLVLREMCKQ
GYRDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQAVESAQAEDYSQLPGEDHILEHL
PARLNEALLEACVEPTDLLTTLSNMLPVRLATAMMVPYTLPLESALSFTIRLLEWLPDVP
EDIRWMKEQTGSICQYLVMRAKRKLGRHLPSRLPEQVELRRVQSLPSVPLSCAAYREALP
GWMRNNLSLGDALAKWEECQRQLLLGLFCTNVAFPPEALRMRAPADPAPAPADPASPQHQ
LAGPAPLLSTPAPEARPVIGALGL
Sequence length 504
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Glycerolipid metabolism
Metabolic pathways
Thermogenesis
Regulation of lipolysis in adipocytes
  Acyl chain remodeling of DAG and TAG
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Cardiomyopathy Cardiomyopathies, Cardiomyopathy, Familial Idiopathic rs267607003, rs267607002, rs267607004, rs63750743, rs121908333, rs121908334, rs104894655, rs121434420, rs121434421, rs193922674, rs111517471, rs121908987, rs193922384, rs121909374, rs121909377
View all (900 more)
Diabetes mellitus Diabetes Mellitus rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)
Hearing loss Sensorineural Hearing Loss (disorder) rs267607135, rs267606855, rs779841884, rs267606854, rs28942097, rs121908073, rs121908076, rs74315289, rs121908144, rs111033313, rs74315437, rs121908348, rs121908349, rs121908350, rs397515359
View all (184 more)
Mental retardation Mild Mental Retardation rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)
Unknown
Disease term Disease name Evidence References Source
Congestive heart failure Congestive heart failure ClinVar
Pancreatitis Pancreatitis, Chronic ClinVar
Keratoconus Keratoconus GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 37985446
Atherosclerosis Associate 21828047
Atrophy Associate 25956450
Breast Neoplasms Associate 33380715
Carcinoma Hepatocellular Associate 30918066, 31476254
Carcinoma Squamous Cell Associate 37985446
Cardiomyopathies Associate 30223778, 31655616
Chanarin Dorfman Syndrome Associate 19208393, 21828047, 36326420
Colorectal Neoplasms Associate 36849520
Congenital Abnormalities Associate 22964912