Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
571
Gene name Gene Name - the full gene name approved by the HGNC.
BTB domain and CNC homolog 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BACH1
Synonyms (NCBI Gene) Gene synonyms aliases
BACH-1, BTBD24
Chromosome Chromosome number
21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
21q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a transcription factor that belongs to the cap`n`collar type of basic region leucine zipper factor family (CNC-bZip). The encoded protein contains broad complex, tramtrack, bric-a-brac/poxvirus and zinc finger (BTB/POZ) domains, which is
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001043 hsa-miR-155-5p Luciferase reporter assay 17881434
MIRT001043 hsa-miR-155-5p Luciferase reporter assay 17881434
MIRT001043 hsa-miR-155-5p Luciferase reporter assay 17881434
MIRT001043 hsa-miR-155-5p Luciferase reporter assay 17881434
MIRT003981 kshv-miR-K12-11-3p Luciferase reporter assay 17881434
Transcription factors
Transcription factor Regulation Reference
BRCA1 Unknown 14576433
GATA1 Activation 16492768
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 12511571, 24035498
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 21555518
GO:0000122 Process Negative regulation of transcription by RNA polymerase II NAS 33897412
GO:0000785 Component Chromatin ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602751 935 ENSG00000156273
Protein
UniProt ID O14867
Protein name Transcription regulator protein BACH1 (BTB and CNC homolog 1) (HA2303)
Protein function Transcriptional regulator that acts as a repressor or activator, depending on the context. Binds to NF-E2 DNA binding sites. Plays important roles in coordinating transcription activation and repression by MAFK (By similarity). Together with MAF
PDB 2IHC , 8S7D , 8UA3 , 8UA6 , 8UAH , 8UBT , 8UBU , 8UBV , 9GP5 , 9GR9 , 9GRA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00651 BTB 24 129 BTB/POZ domain Domain
PF03131 bZIP_Maf 528 622 bZIP Maf transcription factor Coiled-coil
Sequence
MSLSENSVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVEGQRFRAHRSVLAACSSYFH
SRIVGQADGELNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEE
SCFQFLKFK
FLDSTADQQECPRKKCFSSHCQKTDLKLSLLDQRDLETDEVEEFLENKNVQ
TPQCKLRRYQGNAKASPPLQDSASQTYESMCLEKDAALALPSLCPKYRKFQKAFGTDRVR
TGESSVKDIHASVQPNERSENECLGGVPECRDLQVMLKCDESKLAMEPEETKKDPASQCP
TEKSEVTPFPHNSSIDPHGLYSLSLLHTYDQYGDLNFAGMQNTTVLTEKPLSGTDVQEKT
FGESQDLPLKSDLGTREDSSVASSDRSSVEREVAEHLAKGFWSDICSTDTPCQMQLSPAV
AKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGN
DDYVSEPQQEPCPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIISLSRND
FQSLLKMHKLTPEQLDCIHDIRRRSKNRIAAQRCRKRKLDCIQNLESEIEKLQSEKESLL
KERDHILSTLGETKQNLTGLCQ
KVCKEAALSQEQIQILAKYSAADCPLSFLISEKDKSTP
DGELALPSIFSLSDRPPAVLPPCARGNSEPGYARGQESQQMSTATSEQAGPAEQCRQSGG
ISDFCQQMTDKCTTDE
Sequence length 736
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Eosinophilia Eosinophilic esophagitis N/A N/A GWAS
Heart Failure Heart failure N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Myocardial Infarction Myocardial infarction N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 40186888
Adenocarcinoma of Lung Associate 31939443, 35035660, 35801241, 37311571
Alzheimer Disease Associate 36334414
Anemia Hemolytic Associate 30755497
beta Thalassemia Associate 26377036
Breast Neoplasms Associate 11301010, 14983014, 15125843, 15878853, 16430786, 17145708, 17596542, 18628483, 23021409, 24366869, 24395801, 28349828, 28889753, 34351577, 36084789
View all (4 more)
Breast Neoplasms Inhibit 20173781
Carcinogenesis Associate 17145708
Carcinoma Hepatocellular Associate 20127796, 35154476, 36419136
Carcinoma Non Small Cell Lung Associate 32228546