Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5709
Gene name Gene Name - the full gene name approved by the HGNC.	Proteasome 26S subunit, non-ATPase 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PSMD3
Synonyms (NCBI Gene) Gene synonyms aliases	P58, RPN3, S3, TSTA2
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q21.1
Summary Summary of gene provided in NCBI Entrez Gene.	The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

Show/Hide all(182)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049247	hsa-miR-92a-3p	CLASH	23622248
MIRT045113	hsa-miR-186-5p	CLASH	23622248
MIRT044009	hsa-miR-378a-5p	CLASH	23622248
MIRT040625	hsa-miR-92b-3p	CLASH	23622248
MIRT039148	hsa-miR-769-5p	CLASH	23622248
MIRT036722	hsa-miR-760	CLASH	23622248
MIRT490810	hsa-miR-1276	PAR-CLIP	23592263
MIRT490809	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT490808	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT490807	hsa-miR-6814-5p	PAR-CLIP	23592263
MIRT490805	hsa-miR-4292	PAR-CLIP	23592263
MIRT490806	hsa-miR-6791-5p	PAR-CLIP	23592263
MIRT490804	hsa-miR-939-3p	PAR-CLIP	23592263
MIRT490803	hsa-miR-1285-3p	PAR-CLIP	23592263
MIRT490802	hsa-miR-3187-5p	PAR-CLIP	23592263
MIRT490801	hsa-miR-5189-5p	PAR-CLIP	23592263
MIRT490799	hsa-miR-612	PAR-CLIP	23592263
MIRT490800	hsa-miR-6860	PAR-CLIP	23592263
MIRT490798	hsa-miR-6859-3p	PAR-CLIP	23592263
MIRT490797	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT490796	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT490795	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT490794	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT490793	hsa-miR-3153	PAR-CLIP	23592263
MIRT490792	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT490791	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT490790	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT490789	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT490788	hsa-miR-224-5p	PAR-CLIP	23592263
MIRT490787	hsa-miR-181d-3p	PAR-CLIP	23592263
MIRT490786	hsa-miR-4667-5p	PAR-CLIP	23592263
MIRT490784	hsa-miR-4700-5p	PAR-CLIP	23592263
MIRT490785	hsa-miR-8089	PAR-CLIP	23592263
MIRT490783	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT490782	hsa-miR-765	PAR-CLIP	23592263
MIRT490781	hsa-miR-4505	PAR-CLIP	23592263
MIRT490780	hsa-miR-5787	PAR-CLIP	23592263
MIRT490779	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT490778	hsa-miR-3175	PAR-CLIP	23592263
MIRT490777	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT490776	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT490774	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT490775	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT490773	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT490810	hsa-miR-1276	PAR-CLIP	23592263
MIRT490809	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT490808	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT490807	hsa-miR-6814-5p	PAR-CLIP	23592263
MIRT490805	hsa-miR-4292	PAR-CLIP	23592263
MIRT490806	hsa-miR-6791-5p	PAR-CLIP	23592263
MIRT490804	hsa-miR-939-3p	PAR-CLIP	23592263
MIRT490803	hsa-miR-1285-3p	PAR-CLIP	23592263
MIRT490802	hsa-miR-3187-5p	PAR-CLIP	23592263
MIRT490801	hsa-miR-5189-5p	PAR-CLIP	23592263
MIRT490799	hsa-miR-612	PAR-CLIP	23592263
MIRT490800	hsa-miR-6860	PAR-CLIP	23592263
MIRT490798	hsa-miR-6859-3p	PAR-CLIP	23592263
MIRT490797	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT490796	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT490795	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT490794	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT490793	hsa-miR-3153	PAR-CLIP	23592263
MIRT490792	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT490791	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT490790	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT490789	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT490788	hsa-miR-224-5p	PAR-CLIP	23592263
MIRT490787	hsa-miR-181d-3p	PAR-CLIP	23592263
MIRT490786	hsa-miR-4667-5p	PAR-CLIP	23592263
MIRT490784	hsa-miR-4700-5p	PAR-CLIP	23592263
MIRT490785	hsa-miR-8089	PAR-CLIP	23592263
MIRT490783	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT490782	hsa-miR-765	PAR-CLIP	23592263
MIRT490781	hsa-miR-4505	PAR-CLIP	23592263
MIRT490780	hsa-miR-5787	PAR-CLIP	23592263
MIRT490779	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT490778	hsa-miR-3175	PAR-CLIP	23592263
MIRT490777	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT490776	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT490774	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT490775	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT490773	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT1270515	hsa-miR-101	CLIP-seq
MIRT1270516	hsa-miR-103a	CLIP-seq
MIRT1270517	hsa-miR-107	CLIP-seq
MIRT1270518	hsa-miR-1233	CLIP-seq
MIRT1270519	hsa-miR-1275	CLIP-seq
MIRT1270520	hsa-miR-144	CLIP-seq
MIRT1270521	hsa-miR-224	CLIP-seq
MIRT1270522	hsa-miR-3065-3p	CLIP-seq
MIRT1270523	hsa-miR-3160-3p	CLIP-seq
MIRT1270524	hsa-miR-370	CLIP-seq
MIRT1270525	hsa-miR-4487	CLIP-seq
MIRT1270526	hsa-miR-4525	CLIP-seq
MIRT1270527	hsa-miR-4640-3p	CLIP-seq
MIRT1270528	hsa-miR-4665-5p	CLIP-seq
MIRT1270529	hsa-miR-4718	CLIP-seq
MIRT1270530	hsa-miR-4723-5p	CLIP-seq
MIRT1270531	hsa-miR-4763-5p	CLIP-seq
MIRT1270532	hsa-miR-556-5p	CLIP-seq
MIRT1270533	hsa-miR-558	CLIP-seq
MIRT1270534	hsa-miR-625	CLIP-seq
MIRT1270535	hsa-miR-637	CLIP-seq
MIRT1270536	hsa-miR-939	CLIP-seq
MIRT2079495	hsa-miR-147	CLIP-seq
MIRT1270522	hsa-miR-3065-3p	CLIP-seq
MIRT2079496	hsa-miR-3144-5p	CLIP-seq
MIRT1270523	hsa-miR-3160-3p	CLIP-seq
MIRT2079497	hsa-miR-3191	CLIP-seq
MIRT2079498	hsa-miR-3911	CLIP-seq
MIRT1270525	hsa-miR-4487	CLIP-seq
MIRT1270527	hsa-miR-4640-3p	CLIP-seq
MIRT2079499	hsa-miR-4648	CLIP-seq
MIRT2079500	hsa-miR-4652-5p	CLIP-seq
MIRT2079501	hsa-miR-4654	CLIP-seq
MIRT2079502	hsa-miR-4668-5p	CLIP-seq
MIRT2079503	hsa-miR-4769-5p	CLIP-seq
MIRT1270533	hsa-miR-558	CLIP-seq
MIRT2079504	hsa-miR-644	CLIP-seq
MIRT1270515	hsa-miR-101	CLIP-seq
MIRT1270516	hsa-miR-103a	CLIP-seq
MIRT1270517	hsa-miR-107	CLIP-seq
MIRT1270518	hsa-miR-1233	CLIP-seq
MIRT1270519	hsa-miR-1275	CLIP-seq
MIRT2305788	hsa-miR-1285	CLIP-seq
MIRT1270520	hsa-miR-144	CLIP-seq
MIRT2305789	hsa-miR-149	CLIP-seq
MIRT2305790	hsa-miR-188-3p	CLIP-seq
MIRT2305791	hsa-miR-1909	CLIP-seq
MIRT2305792	hsa-miR-1976	CLIP-seq
MIRT2305793	hsa-miR-2114	CLIP-seq
MIRT1270521	hsa-miR-224	CLIP-seq
MIRT2305794	hsa-miR-300	CLIP-seq
MIRT1270522	hsa-miR-3065-3p	CLIP-seq
MIRT2079496	hsa-miR-3144-5p	CLIP-seq
MIRT1270523	hsa-miR-3160-3p	CLIP-seq
MIRT2305795	hsa-miR-3168	CLIP-seq
MIRT2305796	hsa-miR-3613-3p	CLIP-seq
MIRT2305797	hsa-miR-361-3p	CLIP-seq
MIRT2305798	hsa-miR-3617	CLIP-seq
MIRT2305799	hsa-miR-362-5p	CLIP-seq
MIRT2305800	hsa-miR-3652	CLIP-seq
MIRT2305801	hsa-miR-3667-3p	CLIP-seq
MIRT1270524	hsa-miR-370	CLIP-seq
MIRT2305802	hsa-miR-381	CLIP-seq
MIRT2305803	hsa-miR-4277	CLIP-seq
MIRT2305804	hsa-miR-4286	CLIP-seq
MIRT2305805	hsa-miR-4423-5p	CLIP-seq
MIRT2305806	hsa-miR-4430	CLIP-seq
MIRT2305807	hsa-miR-4435	CLIP-seq
MIRT1270525	hsa-miR-4487	CLIP-seq
MIRT2305808	hsa-miR-4509	CLIP-seq
MIRT1270526	hsa-miR-4525	CLIP-seq
MIRT2305809	hsa-miR-4532	CLIP-seq
MIRT1270527	hsa-miR-4640-3p	CLIP-seq
MIRT1270528	hsa-miR-4665-5p	CLIP-seq
MIRT2305810	hsa-miR-4667-3p	CLIP-seq
MIRT2305811	hsa-miR-4672	CLIP-seq
MIRT1270529	hsa-miR-4718	CLIP-seq
MIRT2305812	hsa-miR-4722-3p	CLIP-seq
MIRT1270530	hsa-miR-4723-5p	CLIP-seq
MIRT2305813	hsa-miR-4725-5p	CLIP-seq
MIRT1270531	hsa-miR-4763-5p	CLIP-seq
MIRT2305814	hsa-miR-500b	CLIP-seq
MIRT2305815	hsa-miR-501-5p	CLIP-seq
MIRT2305816	hsa-miR-504	CLIP-seq
MIRT2305817	hsa-miR-532-3p	CLIP-seq
MIRT2305818	hsa-miR-548c-3p	CLIP-seq
MIRT2305819	hsa-miR-554	CLIP-seq
MIRT1270532	hsa-miR-556-5p	CLIP-seq
MIRT1270533	hsa-miR-558	CLIP-seq
MIRT1270534	hsa-miR-625	CLIP-seq
MIRT1270535	hsa-miR-637	CLIP-seq
MIRT2305820	hsa-miR-641	CLIP-seq
MIRT1270536	hsa-miR-939	CLIP-seq
MIRT1270518	hsa-miR-1233	CLIP-seq
MIRT1270534	hsa-miR-625	CLIP-seq
MIRT1270535	hsa-miR-637	CLIP-seq
MIRT1270536	hsa-miR-939	CLIP-seq
MIRT2457362	hsa-miR-2355-5p	CLIP-seq
MIRT2457363	hsa-miR-3162-3p	CLIP-seq
MIRT2457364	hsa-miR-3679-3p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
BRCA2	Unknown	17563742

Show/Hide all(41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0005515	Function	Protein binding	IPI	15147878, 25416956, 25814554, 25910212, 26030138, 31515488, 32296183, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0008541	Component	Proteasome regulatory particle, lid subcomplex	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016579	Process	Protein deubiquitination	TAS
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0030234	Function	Enzyme regulator activity	IEA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0042176	Process	Regulation of protein catabolic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0050790	Process	Regulation of catalytic activity	IEA
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
617676	9560	ENSG00000108344

Protein

UniProt ID

O43242

Protein name

26S proteasome non-ATPase regulatory subunit 3 (26S proteasome regulatory subunit RPN3) (26S proteasome regulatory subunit S3) (Proteasome subunit p58)

Protein function

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which

PDB

5GJQ , 5GJR , 5L4K , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VGZ , 5VHF , 5VHH , 5VHI , 5VHS , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6WJD , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 7W37 , 7W38 , 7W39 , 7W3A , 7W3B , 7W3C , 7W3F , 7W3G , 7W3H , 7W3I , 7W3J , 7W3K , 7W3M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01399	PCI	358 → 462	PCI domain	Domain
PF08375	Rpn3_C	465 → 532	Proteasome regulatory subunit C-terminal	Family

Sequence

MKQEGSARRRGADKAKPPPGGGEQEPPPPPAPQDVEMKEEAATGGGSTGEADGKTAAAAA
EHSQRELDTVTLEDIKEHVKQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVQGF
FTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAASTPLLPEVEAYLQLLVVIFMMNSKR
YKEAQKISDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATL
RHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQL
EYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPY
FLLTQAVRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLA
DIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRI
SFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSFP

Sequence length

534

Interactions

View interactions

	KEGG		Reactome
	Proteasome Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Spinocerebellar ataxia Prion disease Pathways of neurodegeneration - multiple diseases Epstein-Barr virus infection		Activation of NF-kappaB in B cells Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha Cross-presentation of soluble exogenous antigens (endosomes) Autodegradation of Cdh1 by Cdh1:APC/C SCF-beta-TrCP mediated degradation of Emi1 APC/C:Cdc20 mediated degradation of Securin APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 Cdc20:Phospho-APC/C mediated degradation of Cyclin A Vpu mediated degradation of CD4 Vif-mediated degradation of APOBEC3G SCF(Skp2)-mediated degradation of p27/p21 Degradation of beta-catenin by the destruction complex Downstream TCR signaling Separation of Sister Chromatids FCERI mediated NF-kB activation Autodegradation of the E3 ubiquitin ligase COP1 Regulation of ornithine decarboxylase (ODC) ABC-family proteins mediated transport AUF1 (hnRNP D0) binds and destabilizes mRNA Asymmetric localization of PCP proteins Degradation of AXIN Degradation of DVL Hedgehog ligand biogenesis Hh mutants that don't undergo autocatalytic processing are degraded by ERAD Dectin-1 mediated noncanonical NF-kB signaling CLEC7A (Dectin-1) signaling Degradation of GLI1 by the proteasome GLI3 is processed to GLI3R by the proteasome Hedgehog 'on' state Regulation of RAS by GAPs TNFR2 non-canonical NF-kB pathway NIK-->noncanonical NF-kB signaling Defective CFTR causes cystic fibrosis MAPK6/MAPK4 signaling UCH proteinases Ub-specific processing proteases Neutrophil degranulation CDT1 association with the CDC6:ORC:origin complex Orc1 removal from chromatin CDK-mediated phosphorylation and removal of Cdc6 G2/M Checkpoints Ubiquitin Mediated Degradation of Phosphorylated Cdc25A Ubiquitin-dependent degradation of Cyclin D The role of GTSE1 in G2/M progression after G2 checkpoint FBXL7 down-regulates AURKA during mitotic entry and in early mitosis RUNX1 regulates transcription of genes involved in differentiation of HSCs Regulation of RUNX2 expression and activity Regulation of RUNX3 expression and activity Regulation of PTEN stability and activity Neddylation Interleukin-1 signaling Antigen processing: Ubiquitination & Proteasome degradation

Show/Hide Unknown Diseases (2)

Disease term	Disease name	References	Source
Unknown
Asthma	Asthma	31619474, 20860503	ClinVar, GWAS
Bipolar Disorder	Bipolar Disorder		GWAS

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References
Associations from Text Mining
Asthma	Associate	22037903
Breast Neoplasms	Stimulate	34839279
Crohn Disease	Associate	22037903
Glioblastoma	Associate	24068912
Inflammation	Associate	22037903
Insulin Resistance	Associate	23303871
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	34572038, 36498916
Leukemia Myeloid Acute	Associate	36498916
Microphthalmia Syndromic 6	Associate	28390009
Myositis	Associate	27388770
Neoplasms	Associate	21829568, 34572038, 36498916
Ovarian Neoplasms	Associate	37349676
Stomach Neoplasms	Associate	29286091
Thyroiditis	Associate	28390009

PSMD3 (proteasome 26S subunit, non-ATPase 3)