Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5709
Gene name	Proteasome 26S subunit, non-ATPase 3
Gene symbol	PSMD3
Synonyms (NCBI Gene)	P58RPN3S3TSTA2
Chromosome	17
Chromosome location	17q21.1
Summary	The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

182

Show/Hide all (182)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049247	hsa-miR-92a-3p	CLASH	23622248
MIRT045113	hsa-miR-186-5p	CLASH	23622248
MIRT044009	hsa-miR-378a-5p	CLASH	23622248
MIRT040625	hsa-miR-92b-3p	CLASH	23622248
MIRT039148	hsa-miR-769-5p	CLASH	23622248
MIRT036722	hsa-miR-760	CLASH	23622248
MIRT490810	hsa-miR-1276	PAR-CLIP	23592263
MIRT490809	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT490808	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT490807	hsa-miR-6814-5p	PAR-CLIP	23592263
MIRT490805	hsa-miR-4292	PAR-CLIP	23592263
MIRT490806	hsa-miR-6791-5p	PAR-CLIP	23592263
MIRT490804	hsa-miR-939-3p	PAR-CLIP	23592263
MIRT490803	hsa-miR-1285-3p	PAR-CLIP	23592263
MIRT490802	hsa-miR-3187-5p	PAR-CLIP	23592263
MIRT490801	hsa-miR-5189-5p	PAR-CLIP	23592263
MIRT490799	hsa-miR-612	PAR-CLIP	23592263
MIRT490800	hsa-miR-6860	PAR-CLIP	23592263
MIRT490798	hsa-miR-6859-3p	PAR-CLIP	23592263
MIRT490797	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT490796	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT490795	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT490794	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT490793	hsa-miR-3153	PAR-CLIP	23592263
MIRT490792	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT490791	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT490790	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT490789	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT490788	hsa-miR-224-5p	PAR-CLIP	23592263
MIRT490787	hsa-miR-181d-3p	PAR-CLIP	23592263
MIRT490786	hsa-miR-4667-5p	PAR-CLIP	23592263
MIRT490784	hsa-miR-4700-5p	PAR-CLIP	23592263
MIRT490785	hsa-miR-8089	PAR-CLIP	23592263
MIRT490783	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT490782	hsa-miR-765	PAR-CLIP	23592263
MIRT490781	hsa-miR-4505	PAR-CLIP	23592263
MIRT490780	hsa-miR-5787	PAR-CLIP	23592263
MIRT490779	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT490778	hsa-miR-3175	PAR-CLIP	23592263
MIRT490777	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT490776	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT490774	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT490775	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT490773	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT490810	hsa-miR-1276	PAR-CLIP	23592263
MIRT490809	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT490808	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT490807	hsa-miR-6814-5p	PAR-CLIP	23592263
MIRT490805	hsa-miR-4292	PAR-CLIP	23592263
MIRT490806	hsa-miR-6791-5p	PAR-CLIP	23592263
MIRT490804	hsa-miR-939-3p	PAR-CLIP	23592263
MIRT490803	hsa-miR-1285-3p	PAR-CLIP	23592263
MIRT490802	hsa-miR-3187-5p	PAR-CLIP	23592263
MIRT490801	hsa-miR-5189-5p	PAR-CLIP	23592263
MIRT490799	hsa-miR-612	PAR-CLIP	23592263
MIRT490800	hsa-miR-6860	PAR-CLIP	23592263
MIRT490798	hsa-miR-6859-3p	PAR-CLIP	23592263
MIRT490797	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT490796	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT490795	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT490794	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT490793	hsa-miR-3153	PAR-CLIP	23592263
MIRT490792	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT490791	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT490790	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT490789	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT490788	hsa-miR-224-5p	PAR-CLIP	23592263
MIRT490787	hsa-miR-181d-3p	PAR-CLIP	23592263
MIRT490786	hsa-miR-4667-5p	PAR-CLIP	23592263
MIRT490784	hsa-miR-4700-5p	PAR-CLIP	23592263
MIRT490785	hsa-miR-8089	PAR-CLIP	23592263
MIRT490783	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT490782	hsa-miR-765	PAR-CLIP	23592263
MIRT490781	hsa-miR-4505	PAR-CLIP	23592263
MIRT490780	hsa-miR-5787	PAR-CLIP	23592263
MIRT490779	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT490778	hsa-miR-3175	PAR-CLIP	23592263
MIRT490777	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT490776	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT490774	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT490775	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT490773	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT1270515	hsa-miR-101	CLIP-seq
MIRT1270516	hsa-miR-103a	CLIP-seq
MIRT1270517	hsa-miR-107	CLIP-seq
MIRT1270518	hsa-miR-1233	CLIP-seq
MIRT1270519	hsa-miR-1275	CLIP-seq
MIRT1270520	hsa-miR-144	CLIP-seq
MIRT1270521	hsa-miR-224	CLIP-seq
MIRT1270522	hsa-miR-3065-3p	CLIP-seq
MIRT1270523	hsa-miR-3160-3p	CLIP-seq
MIRT1270524	hsa-miR-370	CLIP-seq
MIRT1270525	hsa-miR-4487	CLIP-seq
MIRT1270526	hsa-miR-4525	CLIP-seq
MIRT1270527	hsa-miR-4640-3p	CLIP-seq
MIRT1270528	hsa-miR-4665-5p	CLIP-seq
MIRT1270529	hsa-miR-4718	CLIP-seq
MIRT1270530	hsa-miR-4723-5p	CLIP-seq
MIRT1270531	hsa-miR-4763-5p	CLIP-seq
MIRT1270532	hsa-miR-556-5p	CLIP-seq
MIRT1270533	hsa-miR-558	CLIP-seq
MIRT1270534	hsa-miR-625	CLIP-seq
MIRT1270535	hsa-miR-637	CLIP-seq
MIRT1270536	hsa-miR-939	CLIP-seq
MIRT2079495	hsa-miR-147	CLIP-seq
MIRT1270522	hsa-miR-3065-3p	CLIP-seq
MIRT2079496	hsa-miR-3144-5p	CLIP-seq
MIRT1270523	hsa-miR-3160-3p	CLIP-seq
MIRT2079497	hsa-miR-3191	CLIP-seq
MIRT2079498	hsa-miR-3911	CLIP-seq
MIRT1270525	hsa-miR-4487	CLIP-seq
MIRT1270527	hsa-miR-4640-3p	CLIP-seq
MIRT2079499	hsa-miR-4648	CLIP-seq
MIRT2079500	hsa-miR-4652-5p	CLIP-seq
MIRT2079501	hsa-miR-4654	CLIP-seq
MIRT2079502	hsa-miR-4668-5p	CLIP-seq
MIRT2079503	hsa-miR-4769-5p	CLIP-seq
MIRT1270533	hsa-miR-558	CLIP-seq
MIRT2079504	hsa-miR-644	CLIP-seq
MIRT1270515	hsa-miR-101	CLIP-seq
MIRT1270516	hsa-miR-103a	CLIP-seq
MIRT1270517	hsa-miR-107	CLIP-seq
MIRT1270518	hsa-miR-1233	CLIP-seq
MIRT1270519	hsa-miR-1275	CLIP-seq
MIRT2305788	hsa-miR-1285	CLIP-seq
MIRT1270520	hsa-miR-144	CLIP-seq
MIRT2305789	hsa-miR-149	CLIP-seq
MIRT2305790	hsa-miR-188-3p	CLIP-seq
MIRT2305791	hsa-miR-1909	CLIP-seq
MIRT2305792	hsa-miR-1976	CLIP-seq
MIRT2305793	hsa-miR-2114	CLIP-seq
MIRT1270521	hsa-miR-224	CLIP-seq
MIRT2305794	hsa-miR-300	CLIP-seq
MIRT1270522	hsa-miR-3065-3p	CLIP-seq
MIRT2079496	hsa-miR-3144-5p	CLIP-seq
MIRT1270523	hsa-miR-3160-3p	CLIP-seq
MIRT2305795	hsa-miR-3168	CLIP-seq
MIRT2305796	hsa-miR-3613-3p	CLIP-seq
MIRT2305797	hsa-miR-361-3p	CLIP-seq
MIRT2305798	hsa-miR-3617	CLIP-seq
MIRT2305799	hsa-miR-362-5p	CLIP-seq
MIRT2305800	hsa-miR-3652	CLIP-seq
MIRT2305801	hsa-miR-3667-3p	CLIP-seq
MIRT1270524	hsa-miR-370	CLIP-seq
MIRT2305802	hsa-miR-381	CLIP-seq
MIRT2305803	hsa-miR-4277	CLIP-seq
MIRT2305804	hsa-miR-4286	CLIP-seq
MIRT2305805	hsa-miR-4423-5p	CLIP-seq
MIRT2305806	hsa-miR-4430	CLIP-seq
MIRT2305807	hsa-miR-4435	CLIP-seq
MIRT1270525	hsa-miR-4487	CLIP-seq
MIRT2305808	hsa-miR-4509	CLIP-seq
MIRT1270526	hsa-miR-4525	CLIP-seq
MIRT2305809	hsa-miR-4532	CLIP-seq
MIRT1270527	hsa-miR-4640-3p	CLIP-seq
MIRT1270528	hsa-miR-4665-5p	CLIP-seq
MIRT2305810	hsa-miR-4667-3p	CLIP-seq
MIRT2305811	hsa-miR-4672	CLIP-seq
MIRT1270529	hsa-miR-4718	CLIP-seq
MIRT2305812	hsa-miR-4722-3p	CLIP-seq
MIRT1270530	hsa-miR-4723-5p	CLIP-seq
MIRT2305813	hsa-miR-4725-5p	CLIP-seq
MIRT1270531	hsa-miR-4763-5p	CLIP-seq
MIRT2305814	hsa-miR-500b	CLIP-seq
MIRT2305815	hsa-miR-501-5p	CLIP-seq
MIRT2305816	hsa-miR-504	CLIP-seq
MIRT2305817	hsa-miR-532-3p	CLIP-seq
MIRT2305818	hsa-miR-548c-3p	CLIP-seq
MIRT2305819	hsa-miR-554	CLIP-seq
MIRT1270532	hsa-miR-556-5p	CLIP-seq
MIRT1270533	hsa-miR-558	CLIP-seq
MIRT1270534	hsa-miR-625	CLIP-seq
MIRT1270535	hsa-miR-637	CLIP-seq
MIRT2305820	hsa-miR-641	CLIP-seq
MIRT1270536	hsa-miR-939	CLIP-seq
MIRT1270518	hsa-miR-1233	CLIP-seq
MIRT1270534	hsa-miR-625	CLIP-seq
MIRT1270535	hsa-miR-637	CLIP-seq
MIRT1270536	hsa-miR-939	CLIP-seq
MIRT2457362	hsa-miR-2355-5p	CLIP-seq
MIRT2457363	hsa-miR-3162-3p	CLIP-seq
MIRT2457364	hsa-miR-3679-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
BRCA2	Unknown	17563742

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	NAS	29636472
GO:0000502	Component	Proteasome complex	TAS	8811196
GO:0005515	Function	Protein binding	IPI	15147878, 16990800, 25036637, 25416956, 25814554, 25910212, 26030138, 31515488, 32296183, 32814053, 33961781, 35271311
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005838	Component	Proteasome regulatory particle	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0008541	Component	Proteasome regulatory particle, lid subcomplex	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0022624	Component	Proteasome accessory complex	IEA
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0030234	Function	Enzyme regulator activity	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0042176	Process	Regulation of protein catabolic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	19489727
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
617676	9560	ENSG00000108344

O43242

Protein name

26S proteasome non-ATPase regulatory subunit 3 (26S proteasome regulatory subunit RPN3) (26S proteasome regulatory subunit S3) (Proteasome subunit p58)

Protein function

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which

PDB

5GJQ , 5GJR , 5L4K , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VGZ , 5VHF , 5VHH , 5VHI , 5VHS , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6WJD , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 7W37 , 7W38 , 7W39 , 7W3A , 7W3B , 7W3C , 7W3F , 7W3G , 7W3H , 7W3I , 7W3J , 7W3K , 7W3M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01399	PCI	358 → 462	PCI domain	Domain
PF08375	Rpn3_C	465 → 532	Proteasome regulatory subunit C-terminal	Family

Sequence

MKQEGSARRRGADKAKPPPGGGEQEPPPPPAPQDVEMKEEAATGGGSTGEADGKTAAAAA
EHSQRELDTVTLEDIKEHVKQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVQGF
FTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAASTPLLPEVEAYLQLLVVIFMMNSKR
YKEAQKISDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATL
RHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQL
EYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPY
FLLTQAVRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLA
DIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRI
SFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSFP

Sequence length

534

Interactions

View interactions

	KEGG		Reactome
	Proteasome Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Spinocerebellar ataxia Prion disease Pathways of neurodegeneration - multiple diseases Epstein-Barr virus infection		Activation of NF-kappaB in B cells Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha Cross-presentation of soluble exogenous antigens (endosomes) Autodegradation of Cdh1 by Cdh1:APC/C SCF-beta-TrCP mediated degradation of Emi1 APC/C:Cdc20 mediated degradation of Securin APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 Cdc20:Phospho-APC/C mediated degradation of Cyclin A Vpu mediated degradation of CD4 Vif-mediated degradation of APOBEC3G SCF(Skp2)-mediated degradation of p27/p21 Degradation of beta-catenin by the destruction complex Downstream TCR signaling Separation of Sister Chromatids FCERI mediated NF-kB activation Autodegradation of the E3 ubiquitin ligase COP1 Regulation of ornithine decarboxylase (ODC) ABC-family proteins mediated transport AUF1 (hnRNP D0) binds and destabilizes mRNA Asymmetric localization of PCP proteins Degradation of AXIN Degradation of DVL Hedgehog ligand biogenesis Hh mutants that don't undergo autocatalytic processing are degraded by ERAD Dectin-1 mediated noncanonical NF-kB signaling CLEC7A (Dectin-1) signaling Degradation of GLI1 by the proteasome GLI3 is processed to GLI3R by the proteasome Hedgehog 'on' state Regulation of RAS by GAPs TNFR2 non-canonical NF-kB pathway NIK-->noncanonical NF-kB signaling Defective CFTR causes cystic fibrosis MAPK6/MAPK4 signaling UCH proteinases Ub-specific processing proteases Neutrophil degranulation CDT1 association with the CDC6:ORC:origin complex Orc1 removal from chromatin CDK-mediated phosphorylation and removal of Cdc6 G2/M Checkpoints Ubiquitin Mediated Degradation of Phosphorylated Cdc25A Ubiquitin-dependent degradation of Cyclin D The role of GTSE1 in G2/M progression after G2 checkpoint FBXL7 down-regulates AURKA during mitotic entry and in early mitosis RUNX1 regulates transcription of genes involved in differentiation of HSCs Regulation of RUNX2 expression and activity Regulation of RUNX3 expression and activity Regulation of PTEN stability and activity Neddylation Interleukin-1 signaling Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HIV INFECTIONS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Asthma	Associate	22037903	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Stimulate	34839279	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Associate	22037903	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	24068912	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	22037903	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Associate	23303871	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	34572038, 36498916	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	36498916	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microphthalmia Syndromic 6	Associate	28390009	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Associate	27388770	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	21829568, 34572038, 36498916	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	37349676	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	29286091	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Associate	28390009	★★★★★ ★☆☆☆☆ Found in Text Mining only

PSMD3 (proteasome 26S subunit, non-ATPase 3)