Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	57084
Gene name	Solute carrier family 17 member 6
Gene symbol	SLC17A6
Synonyms (NCBI Gene)	DNPIVGLUT2
Chromosome	11
Chromosome location	11p14.3

Show/Hide all (36)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029908	hsa-miR-26b-5p	Microarray	19088304
MIRT1353522	hsa-miR-1193	CLIP-seq
MIRT1353523	hsa-miR-1252	CLIP-seq
MIRT1353524	hsa-miR-2052	CLIP-seq
MIRT1353525	hsa-miR-2116	CLIP-seq
MIRT1353526	hsa-miR-25	CLIP-seq
MIRT1353527	hsa-miR-32	CLIP-seq
MIRT1353528	hsa-miR-331-5p	CLIP-seq
MIRT1353529	hsa-miR-33a	CLIP-seq
MIRT1353530	hsa-miR-33b	CLIP-seq
MIRT1353531	hsa-miR-363	CLIP-seq
MIRT1353532	hsa-miR-367	CLIP-seq
MIRT1353533	hsa-miR-4273	CLIP-seq
MIRT1353534	hsa-miR-4477b	CLIP-seq
MIRT1353535	hsa-miR-4677-5p	CLIP-seq
MIRT1353536	hsa-miR-4694-3p	CLIP-seq
MIRT1353537	hsa-miR-522	CLIP-seq
MIRT1353538	hsa-miR-579	CLIP-seq
MIRT1353539	hsa-miR-629	CLIP-seq
MIRT1353540	hsa-miR-7	CLIP-seq
MIRT1353541	hsa-miR-889	CLIP-seq
MIRT1353542	hsa-miR-92a	CLIP-seq
MIRT1353543	hsa-miR-92b	CLIP-seq
MIRT1353544	hsa-miR-944	CLIP-seq
MIRT2104625	hsa-miR-495	CLIP-seq
MIRT2329069	hsa-miR-19a	CLIP-seq
MIRT2329070	hsa-miR-19b	CLIP-seq
MIRT2329071	hsa-miR-2113	CLIP-seq
MIRT2329072	hsa-miR-2278	CLIP-seq
MIRT2329073	hsa-miR-3065-5p	CLIP-seq
MIRT2329074	hsa-miR-3121-3p	CLIP-seq
MIRT1353533	hsa-miR-4273	CLIP-seq
MIRT2329075	hsa-miR-4282	CLIP-seq
MIRT2329076	hsa-miR-4705	CLIP-seq
MIRT2329077	hsa-miR-576-5p	CLIP-seq
MIRT2329078	hsa-miR-633	CLIP-seq

Show/Hide all (48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005254	Function	Chloride channel activity	IEA
GO:0005254	Function	Chloride channel activity	ISS
GO:0005313	Function	L-glutamate transmembrane transporter activity	IBA
GO:0005313	Function	L-glutamate transmembrane transporter activity	TAS
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	IBA
GO:0005436	Function	Sodium:phosphate symporter activity	IC	33440152
GO:0005436	Function	Sodium:phosphate symporter activity	ISS
GO:0005886	Component	Plasma membrane	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006811	Process	Monoatomic ion transport	TAS
GO:0006814	Process	Sodium ion transport	IEA
GO:0006817	Process	Phosphate ion transport	IEA
GO:0006817	Process	Phosphate ion transport	ISS
GO:0006821	Process	Chloride transport	IEA
GO:0006836	Process	Neurotransmitter transport	IEA
GO:0015291	Function	Secondary active transmembrane transporter activity	IEA
GO:0015293	Function	Symporter activity	IEA
GO:0015297	Function	Antiporter activity	IEA
GO:0015386	Function	Potassium:proton antiporter activity	ISS
GO:0015813	Process	L-glutamate transmembrane transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0030672	Component	Synaptic vesicle membrane	IBA
GO:0030672	Component	Synaptic vesicle membrane	IDA	11698620
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0030672	Component	Synaptic vesicle membrane	TAS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034707	Component	Chloride channel complex	IEA
GO:0035249	Process	Synaptic transmission, glutamatergic	IBA
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0044341	Process	Sodium-dependent phosphate transport	IC	33440152
GO:0044341	Process	Sodium-dependent phosphate transport	ISS
GO:0045202	Component	Synapse	IEA
GO:0050803	Process	Regulation of synapse structure or activity	IBA
GO:0051938	Process	L-glutamate import	IMP	11698620
GO:0055062	Process	Phosphate ion homeostasis	IDA	33440152
GO:0055085	Process	Transmembrane transport	IEA
GO:0060076	Component	Excitatory synapse	IBA
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0098700	Process	Neurotransmitter loading into synaptic vesicle	IBA
GO:0140788	Function	L-glutamate uniporter activity	IDA	11698620
GO:0140788	Function	L-glutamate uniporter activity	ISS
GO:1902476	Process	Chloride transmembrane transport	IEA
GO:1902600	Process	Proton transmembrane transport	IEA
GO:1990384	Process	Hyaloid vascular plexus regression	ISS

MIM	HGNC	e!Ensembl
607563	16703	ENSG00000091664

Q9P2U8

Protein name

Vesicular glutamate transporter 2 (VGluT2) (Differentiation-associated BNPI) (Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter) (Solute carrier family 17 member 6)

Protein function

Multifunctional transporter that transports L-glutamate as well as multiple ions such as chloride, proton, potassium, sodium and phosphate (PubMed:11698620, PubMed:33440152). At the synaptic vesicle membrane, mainly functions as a uniporter whic

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07690	MFS_1	76 → 461	Major Facilitator Superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in adult brain (PubMed:10820226). Expressed in amygdala, caudate nucleus, cerebral cortex, frontal lobe, hippocampus, medulla, occipital lobe, putamen, spinal cord, substantia nigra, subthalamic nucleus, tempora

Sequence

MESVKQRILAPGKEGLKNFAGKSLGQIYRVLEKKQDTGETIELTEDGKPLEVPERKAPLC
DCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGGKVIKEKAKFNWD
PETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGCV
IFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYT
GWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFK
TPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMT
IIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAV
GFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVF
LIAALVHYGGVIFYAIFASGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGT
TKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS

Sequence length

582

Interactions

View interactions

	KEGG		Reactome
	Synaptic vesicle cycle Retrograde endocannabinoid signaling Glutamatergic synapse Nicotine addiction		Organic anion transporters

SLC17A6 (solute carrier family 17 member 6)