Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5706
Gene name	Proteasome 26S subunit, ATPase 6
Gene symbol	PSMC6
Synonyms (NCBI Gene)	RPT5SUG2p42
Chromosome	14
Chromosome location	14q22.1
Summary	The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

Show/Hide all (67)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028910	hsa-miR-26b-5p	Microarray	19088304
MIRT1270370	hsa-miR-101	CLIP-seq
MIRT1270371	hsa-miR-1178	CLIP-seq
MIRT1270372	hsa-miR-144	CLIP-seq
MIRT1270373	hsa-miR-3182	CLIP-seq
MIRT1270374	hsa-miR-3613-3p	CLIP-seq
MIRT1270375	hsa-miR-3686	CLIP-seq
MIRT1270376	hsa-miR-371-5p	CLIP-seq
MIRT1270377	hsa-miR-371b-5p	CLIP-seq
MIRT1270378	hsa-miR-3915	CLIP-seq
MIRT1270379	hsa-miR-3928	CLIP-seq
MIRT1270380	hsa-miR-4517	CLIP-seq
MIRT1270381	hsa-miR-4659a-3p	CLIP-seq
MIRT1270382	hsa-miR-4659b-3p	CLIP-seq
MIRT1270383	hsa-miR-4698	CLIP-seq
MIRT1270384	hsa-miR-4742-3p	CLIP-seq
MIRT1270385	hsa-miR-4760-5p	CLIP-seq
MIRT1270386	hsa-miR-495	CLIP-seq
MIRT1270387	hsa-miR-513a-3p	CLIP-seq
MIRT1270388	hsa-miR-520d-5p	CLIP-seq
MIRT1270389	hsa-miR-524-5p	CLIP-seq
MIRT1270390	hsa-miR-545	CLIP-seq
MIRT1270391	hsa-miR-548c-3p	CLIP-seq
MIRT1270392	hsa-miR-570	CLIP-seq
MIRT1270393	hsa-miR-582-5p	CLIP-seq
MIRT1270394	hsa-miR-600	CLIP-seq
MIRT2079456	hsa-miR-338-5p	CLIP-seq
MIRT1270388	hsa-miR-520d-5p	CLIP-seq
MIRT1270389	hsa-miR-524-5p	CLIP-seq
MIRT1270371	hsa-miR-1178	CLIP-seq
MIRT1270374	hsa-miR-3613-3p	CLIP-seq
MIRT1270376	hsa-miR-371-5p	CLIP-seq
MIRT1270377	hsa-miR-371b-5p	CLIP-seq
MIRT1270383	hsa-miR-4698	CLIP-seq
MIRT1270390	hsa-miR-545	CLIP-seq
MIRT1270391	hsa-miR-548c-3p	CLIP-seq
MIRT1270371	hsa-miR-1178	CLIP-seq
MIRT2602989	hsa-miR-224	CLIP-seq
MIRT2602990	hsa-miR-3144-3p	CLIP-seq
MIRT2602991	hsa-miR-3160-5p	CLIP-seq
MIRT2602992	hsa-miR-323-3p	CLIP-seq
MIRT2602993	hsa-miR-323b-3p	CLIP-seq
MIRT2079456	hsa-miR-338-5p	CLIP-seq
MIRT1270376	hsa-miR-371-5p	CLIP-seq
MIRT1270377	hsa-miR-371b-5p	CLIP-seq
MIRT2602994	hsa-miR-3913-3p	CLIP-seq
MIRT1270380	hsa-miR-4517	CLIP-seq
MIRT1270383	hsa-miR-4698	CLIP-seq
MIRT2602995	hsa-miR-489	CLIP-seq
MIRT1270388	hsa-miR-520d-5p	CLIP-seq
MIRT1270389	hsa-miR-524-5p	CLIP-seq
MIRT1270390	hsa-miR-545	CLIP-seq
MIRT1270371	hsa-miR-1178	CLIP-seq
MIRT2602989	hsa-miR-224	CLIP-seq
MIRT2602990	hsa-miR-3144-3p	CLIP-seq
MIRT2602991	hsa-miR-3160-5p	CLIP-seq
MIRT2602992	hsa-miR-323-3p	CLIP-seq
MIRT2602993	hsa-miR-323b-3p	CLIP-seq
MIRT1270376	hsa-miR-371-5p	CLIP-seq
MIRT1270377	hsa-miR-371b-5p	CLIP-seq
MIRT2602994	hsa-miR-3913-3p	CLIP-seq
MIRT1270380	hsa-miR-4517	CLIP-seq
MIRT1270383	hsa-miR-4698	CLIP-seq
MIRT2602995	hsa-miR-489	CLIP-seq
MIRT1270388	hsa-miR-520d-5p	CLIP-seq
MIRT1270389	hsa-miR-524-5p	CLIP-seq
MIRT1270390	hsa-miR-545	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000502	Component	Proteasome complex	IDA	9464850, 17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	NAS	29636472
GO:0005515	Function	Protein binding	IPI	16189514, 16763564, 16990800, 18845680, 19490896, 20478047, 21516116, 25416956, 26496610, 26871637, 27342858, 28514442, 29636472, 31515488, 32296183, 32814053, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	10419517
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0008540	Component	Proteasome regulatory particle, base subcomplex	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016234	Component	Inclusion body	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0022624	Component	Proteasome accessory complex	IEA
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0030674	Function	Protein-macromolecule adaptor activity	NAS	11590019
GO:0031597	Component	Cytosolic proteasome complex	IEA
GO:0036402	Function	Proteasome-activating activity	IBA
GO:0036402	Function	Proteasome-activating activity	TAS	9464850
GO:0036503	Process	ERAD pathway	IBA
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	19489727
GO:0045899	Process	Positive regulation of RNA polymerase II transcription preinitiation complex assembly	IBA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0090261	Process	Positive regulation of inclusion body assembly	IEA
GO:1901800	Process	Positive regulation of proteasomal protein catabolic process	IC	9464850

MIM	HGNC	e!Ensembl
602708	9553	ENSG00000100519

P62333

Protein name

26S proteasome regulatory subunit 10B (26S proteasome AAA-ATPase subunit RPT4) (Proteasome 26S subunit ATPase 6) (Proteasome subunit p42)

Protein function

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which

PDB

5GJQ , 5GJR , 5L4G , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VGZ , 5VHF , 5VHH , 5VHI , 5VHJ , 5VHM , 5VHN , 5VHO , 5VHP , 5VHQ , 5VHR , 5VHS , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 8CVT , 8JRI , 8JRT , 8JTI , 8K0G , 8USB , 8USC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16450	Prot_ATP_ID_OB	57 → 112	Proteasomal ATPase OB C-terminal domain	Domain
PF00004	AAA	170 → 303	ATPase family associated with various cellular activities (AAA)	Domain
PF17862	AAA_lid_3	325 → 369	AAA+ lid domain	Domain

Sequence

MADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEV
LKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVY
NMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGK
TLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGG
RRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIH
IDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHD
FVVQEDFMKAVRKVADSKKLESKLDYKPV

Sequence length

389

Interactions

View interactions

	KEGG		Reactome
	Proteasome Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Spinocerebellar ataxia Prion disease Pathways of neurodegeneration - multiple diseases Epstein-Barr virus infection		Activation of NF-kappaB in B cells Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha Cross-presentation of soluble exogenous antigens (endosomes) Autodegradation of Cdh1 by Cdh1:APC/C SCF-beta-TrCP mediated degradation of Emi1 APC/C:Cdc20 mediated degradation of Securin APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 Cdc20:Phospho-APC/C mediated degradation of Cyclin A Vpu mediated degradation of CD4 Vif-mediated degradation of APOBEC3G SCF(Skp2)-mediated degradation of p27/p21 Degradation of beta-catenin by the destruction complex Downstream TCR signaling Separation of Sister Chromatids FCERI mediated NF-kB activation Autodegradation of the E3 ubiquitin ligase COP1 Regulation of ornithine decarboxylase (ODC) ABC-family proteins mediated transport AUF1 (hnRNP D0) binds and destabilizes mRNA Asymmetric localization of PCP proteins Degradation of AXIN Degradation of DVL Hedgehog ligand biogenesis Hh mutants that don't undergo autocatalytic processing are degraded by ERAD Dectin-1 mediated noncanonical NF-kB signaling CLEC7A (Dectin-1) signaling Degradation of GLI1 by the proteasome GLI3 is processed to GLI3R by the proteasome Hedgehog 'on' state Regulation of RAS by GAPs TNFR2 non-canonical NF-kB pathway NIK-->noncanonical NF-kB signaling Defective CFTR causes cystic fibrosis MAPK6/MAPK4 signaling UCH proteinases Ub-specific processing proteases CDT1 association with the CDC6:ORC:origin complex Orc1 removal from chromatin CDK-mediated phosphorylation and removal of Cdc6 G2/M Checkpoints Ubiquitin Mediated Degradation of Phosphorylated Cdc25A Ubiquitin-dependent degradation of Cyclin D The role of GTSE1 in G2/M progression after G2 checkpoint FBXL7 down-regulates AURKA during mitotic entry and in early mitosis RUNX1 regulates transcription of genes involved in differentiation of HSCs Regulation of RUNX2 expression and activity Regulation of RUNX3 expression and activity Regulation of PTEN stability and activity Neddylation Interleukin-1 signaling Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Stimulate	34239933	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	37334367	★★★★★ ★☆☆☆☆ Found in Text Mining only
Altitude Sickness	Associate	32299499	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Associate	24875235	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Associate	24875235	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	34329194	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Associate	33054835	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanosis	Associate	30559147	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	28958990	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	34239933	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	34239933, 40083690	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	40083690	★★★★★ ★☆☆☆☆ Found in Text Mining only

PSMC6 (proteasome 26S subunit, ATPase 6)