Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	57030
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 17 member 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC17A7
Synonyms (NCBI Gene) Gene synonyms aliases	BNPI, VGLUT1
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.33
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a vesicle-bound, sodium-dependent phosphate transporter that is specifically expressed in the neuron-rich regions of the brain. It is preferentially associated with the membranes of synaptic vesicles and functions in gl

Show/Hide all(43)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017615	hsa-miR-335-5p	Microarray	18185580
MIRT1353545	hsa-miR-106a	CLIP-seq
MIRT1353546	hsa-miR-106b	CLIP-seq
MIRT1353547	hsa-miR-1245	CLIP-seq
MIRT1353548	hsa-miR-1273f	CLIP-seq
MIRT1353549	hsa-miR-17	CLIP-seq
MIRT1353550	hsa-miR-20a	CLIP-seq
MIRT1353551	hsa-miR-20b	CLIP-seq
MIRT1353552	hsa-miR-3160-3p	CLIP-seq
MIRT1353553	hsa-miR-3177-3p	CLIP-seq
MIRT1353554	hsa-miR-4300	CLIP-seq
MIRT1353555	hsa-miR-4428	CLIP-seq
MIRT1353556	hsa-miR-4765	CLIP-seq
MIRT1353557	hsa-miR-488	CLIP-seq
MIRT1353558	hsa-miR-519a	CLIP-seq
MIRT1353559	hsa-miR-519b-3p	CLIP-seq
MIRT1353560	hsa-miR-519c-3p	CLIP-seq
MIRT1353561	hsa-miR-519d	CLIP-seq
MIRT1353562	hsa-miR-548t	CLIP-seq
MIRT1353563	hsa-miR-920	CLIP-seq
MIRT1353564	hsa-miR-93	CLIP-seq
MIRT2104626	hsa-miR-1286	CLIP-seq
MIRT2104627	hsa-miR-1827	CLIP-seq
MIRT2104628	hsa-miR-4436a	CLIP-seq
MIRT2104629	hsa-miR-940	CLIP-seq
MIRT2329079	hsa-miR-1184	CLIP-seq
MIRT2329080	hsa-miR-1205	CLIP-seq
MIRT2329081	hsa-miR-1301	CLIP-seq
MIRT2329082	hsa-miR-223	CLIP-seq
MIRT2329083	hsa-miR-3158-5p	CLIP-seq
MIRT2329084	hsa-miR-4660	CLIP-seq
MIRT2329085	hsa-miR-4697-3p	CLIP-seq
MIRT2329086	hsa-miR-4704-3p	CLIP-seq
MIRT2329087	hsa-miR-5047	CLIP-seq
MIRT2329088	hsa-miR-622	CLIP-seq
MIRT2459506	hsa-miR-1270	CLIP-seq
MIRT2459507	hsa-miR-4254	CLIP-seq
MIRT2459508	hsa-miR-4292	CLIP-seq
MIRT2459509	hsa-miR-4308	CLIP-seq
MIRT2459510	hsa-miR-4683	CLIP-seq
MIRT2459511	hsa-miR-4781-5p	CLIP-seq
MIRT2459512	hsa-miR-577	CLIP-seq
MIRT2459513	hsa-miR-620	CLIP-seq

Show/Hide all(76)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003407	Process	Neural retina development	IEA
GO:0005254	Function	Chloride channel activity	IEA
GO:0005254	Function	Chloride channel activity	ISS
GO:0005313	Function	L-glutamate transmembrane transporter activity	IBA
GO:0005313	Function	L-glutamate transmembrane transporter activity	IEA
GO:0005313	Function	L-glutamate transmembrane transporter activity	TAS
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	IBA
GO:0005436	Function	Sodium:phosphate symporter activity	IDA	10820226
GO:0005436	Function	Sodium:phosphate symporter activity	IEA
GO:0005436	Function	Sodium:phosphate symporter activity	TAS	8632143
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006811	Process	Monoatomic ion transport	TAS
GO:0006813	Process	Potassium ion transport	IEA
GO:0006813	Process	Potassium ion transport	ISS
GO:0006814	Process	Sodium ion transport	IEA
GO:0006817	Process	Phosphate ion transport	IEA
GO:0006817	Process	Phosphate ion transport	ISS
GO:0006817	Process	Phosphate ion transport	TAS	8632143
GO:0006821	Process	Chloride transport	IEA
GO:0006821	Process	Chloride transport	ISS
GO:0006836	Process	Neurotransmitter transport	IEA
GO:0006836	Process	Neurotransmitter transport	TAS
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0007616	Process	Long-term memory	IEA
GO:0008021	Component	Synaptic vesicle	IEA
GO:0008068	Function	Extracellularly glutamate-gated chloride channel activity	IEA
GO:0015291	Function	Secondary active transmembrane transporter activity	IEA
GO:0015293	Function	Symporter activity	IEA
GO:0015297	Function	Antiporter activity	IEA
GO:0015386	Function	Potassium:proton antiporter activity	IEA
GO:0015386	Function	Potassium:proton antiporter activity	ISS
GO:0015813	Process	L-glutamate transmembrane transport	IEA
GO:0015813	Process	L-glutamate transmembrane transport	ISS
GO:0016020	Component	Membrane	IDA	10820226
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8632143
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0030672	Component	Synaptic vesicle membrane	IBA
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0030672	Component	Synaptic vesicle membrane	ISS
GO:0030672	Component	Synaptic vesicle membrane	TAS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034707	Component	Chloride channel complex	IEA
GO:0035249	Process	Synaptic transmission, glutamatergic	IBA
GO:0035249	Process	Synaptic transmission, glutamatergic	IEA
GO:0035435	Process	Phosphate ion transmembrane transport	IEA
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0044300	Component	Cerebellar mossy fiber	IEA
GO:0044341	Process	Sodium-dependent phosphate transport	IEA
GO:0044341	Process	Sodium-dependent phosphate transport	ISS
GO:0045202	Component	Synapse	IEA
GO:0048786	Component	Presynaptic active zone	IEA
GO:0050803	Process	Regulation of synapse structure or activity	IBA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0051938	Process	L-glutamate import	IEA
GO:0055062	Process	Phosphate ion homeostasis	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0060076	Component	Excitatory synapse	IBA
GO:0060076	Component	Excitatory synapse	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0060203	Component	Clathrin-sculpted glutamate transport vesicle membrane	TAS
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0097401	Process	Synaptic vesicle lumen acidification	IEA
GO:0098700	Process	Neurotransmitter loading into synaptic vesicle	IBA
GO:0098700	Process	Neurotransmitter loading into synaptic vesicle	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0140787	Function	Phosphate ion uniporter activity	IEA
GO:0140787	Function	Phosphate ion uniporter activity	ISS
GO:0140788	Function	L-glutamate uniporter activity	IEA
GO:0140788	Function	L-glutamate uniporter activity	ISS
GO:1900242	Process	Regulation of synaptic vesicle endocytosis	IEA
GO:1902476	Process	Chloride transmembrane transport	IEA

MIM	HGNC	e!Ensembl
605208	16704	ENSG00000104888

Protein

UniProt ID

Q9P2U7

Protein name

Vesicular glutamate transporter 1 (VGluT1) (Brain-specific Na(+)-dependent inorganic phosphate cotransporter) (Solute carrier family 17 member 7)

Protein function

Multifunctional transporter that transports L-glutamate as well as multiple ions such as chloride, proton, potassium, sodium and phosphate (PubMed:10820226). At the synaptic vesicle membrane, mainly functions as an uniporter which transports pre

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07690	MFS_1	68 → 453	Major Facilitator Superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in several regions of the brain including amygdala, cerebellum, cerebral cortex, hippocampus, frontal lobe, medulla, occipital lobe, putamen and temporal lobe. {ECO:0000269|PubMed:10820226}.

Sequence

MEFRQEEFRKLAGRALGKLHRLLEKRQEGAETLELSADGRPVTTQTRDPPVVDCTCFGLP
RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFSWDPETVGLIH
GSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQG
LVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYV
YGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFT
SMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQ
IADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAIS
GFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHY
GGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPS
YGATHSTFQPPRPPPPVRDY

Sequence length

560

Interactions

View interactions

	KEGG		Reactome
	Synaptic vesicle cycle Retrograde endocannabinoid signaling Glutamatergic synapse Nicotine addiction		Glutamate Neurotransmitter Release Cycle Organic anion transporters

SLC17A7 (solute carrier family 17 member 7)