Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	5701
Gene name	Proteasome 26S subunit, ATPase 2
Gene symbol	PSMC2
Synonyms (NCBI Gene)	MSS1Nbla10058RPT1S7
Chromosome	7
Chromosome location	7q22.1
Summary	The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

107

Show/Hide all (107)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031892	hsa-miR-16-5p	Proteomics	18668040
MIRT041958	hsa-miR-484	CLASH	23622248
MIRT721125	hsa-miR-141-5p	HITS-CLIP	19536157
MIRT721124	hsa-miR-5693	HITS-CLIP	19536157
MIRT721123	hsa-miR-194-3p	HITS-CLIP	19536157
MIRT721122	hsa-miR-3161	HITS-CLIP	19536157
MIRT721121	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT721120	hsa-miR-599	HITS-CLIP	19536157
MIRT721125	hsa-miR-141-5p	HITS-CLIP	19536157
MIRT721124	hsa-miR-5693	HITS-CLIP	19536157
MIRT721123	hsa-miR-194-3p	HITS-CLIP	19536157
MIRT721122	hsa-miR-3161	HITS-CLIP	19536157
MIRT721121	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT721120	hsa-miR-599	HITS-CLIP	19536157
MIRT1270315	hsa-miR-127-5p	CLIP-seq
MIRT1270316	hsa-miR-1321	CLIP-seq
MIRT1270317	hsa-miR-144	CLIP-seq
MIRT1270318	hsa-miR-3175	CLIP-seq
MIRT1270319	hsa-miR-3606	CLIP-seq
MIRT1270320	hsa-miR-362-5p	CLIP-seq
MIRT1270321	hsa-miR-4419a	CLIP-seq
MIRT1270322	hsa-miR-4510	CLIP-seq
MIRT1270323	hsa-miR-4645-3p	CLIP-seq
MIRT1270324	hsa-miR-4709-5p	CLIP-seq
MIRT1270325	hsa-miR-4728-5p	CLIP-seq
MIRT1270326	hsa-miR-4739	CLIP-seq
MIRT1270327	hsa-miR-4756-5p	CLIP-seq
MIRT1270328	hsa-miR-4786-3p	CLIP-seq
MIRT1270329	hsa-miR-500b	CLIP-seq
MIRT1270330	hsa-miR-501-5p	CLIP-seq
MIRT1270331	hsa-miR-548n	CLIP-seq
MIRT1270332	hsa-miR-921	CLIP-seq
MIRT1270333	hsa-miR-1258	CLIP-seq
MIRT1270334	hsa-miR-219-2-3p	CLIP-seq
MIRT1270335	hsa-miR-2964a-3p	CLIP-seq
MIRT1270336	hsa-miR-3159	CLIP-seq
MIRT1270337	hsa-miR-3614-5p	CLIP-seq
MIRT1270338	hsa-miR-410	CLIP-seq
MIRT1270339	hsa-miR-4477a	CLIP-seq
MIRT1270340	hsa-miR-4704-3p	CLIP-seq
MIRT1270341	hsa-miR-4796-5p	CLIP-seq
MIRT1270342	hsa-miR-5096	CLIP-seq
MIRT1270343	hsa-miR-561	CLIP-seq
MIRT1270344	hsa-miR-651	CLIP-seq
MIRT1270333	hsa-miR-1258	CLIP-seq
MIRT1270336	hsa-miR-3159	CLIP-seq
MIRT1270338	hsa-miR-410	CLIP-seq
MIRT1270340	hsa-miR-4704-3p	CLIP-seq
MIRT2079454	hsa-miR-4775	CLIP-seq
MIRT1270341	hsa-miR-4796-5p	CLIP-seq
MIRT1270343	hsa-miR-561	CLIP-seq
MIRT2079455	hsa-miR-570	CLIP-seq
MIRT1270344	hsa-miR-651	CLIP-seq
MIRT1270333	hsa-miR-1258	CLIP-seq
MIRT1270336	hsa-miR-3159	CLIP-seq
MIRT1270338	hsa-miR-410	CLIP-seq
MIRT2305759	hsa-miR-610	CLIP-seq
MIRT1270344	hsa-miR-651	CLIP-seq
MIRT2602966	hsa-miR-1185	CLIP-seq
MIRT2602967	hsa-miR-1255a	CLIP-seq
MIRT2602968	hsa-miR-1255b	CLIP-seq
MIRT2602969	hsa-miR-2278	CLIP-seq
MIRT2602970	hsa-miR-3138	CLIP-seq
MIRT2602971	hsa-miR-324-5p	CLIP-seq
MIRT2602972	hsa-miR-338-3p	CLIP-seq
MIRT2602973	hsa-miR-3663-3p	CLIP-seq
MIRT2602974	hsa-miR-3668	CLIP-seq
MIRT2602975	hsa-miR-3679-5p	CLIP-seq
MIRT2602976	hsa-miR-3689a-3p	CLIP-seq
MIRT2602977	hsa-miR-3689c	CLIP-seq
MIRT2602978	hsa-miR-4252	CLIP-seq
MIRT2602979	hsa-miR-4496	CLIP-seq
MIRT2602980	hsa-miR-4520a-3p	CLIP-seq
MIRT2602981	hsa-miR-4666-3p	CLIP-seq
MIRT2602982	hsa-miR-4699-5p	CLIP-seq
MIRT1270325	hsa-miR-4728-5p	CLIP-seq
MIRT2602983	hsa-miR-4732-5p	CLIP-seq
MIRT2602984	hsa-miR-491-3p	CLIP-seq
MIRT1270343	hsa-miR-561	CLIP-seq
MIRT2602985	hsa-miR-562	CLIP-seq
MIRT2602986	hsa-miR-580	CLIP-seq
MIRT2602987	hsa-miR-586	CLIP-seq
MIRT2602988	hsa-miR-941	CLIP-seq
MIRT2602966	hsa-miR-1185	CLIP-seq
MIRT2602967	hsa-miR-1255a	CLIP-seq
MIRT2602968	hsa-miR-1255b	CLIP-seq
MIRT2602969	hsa-miR-2278	CLIP-seq
MIRT2602970	hsa-miR-3138	CLIP-seq
MIRT2602971	hsa-miR-324-5p	CLIP-seq
MIRT2602973	hsa-miR-3663-3p	CLIP-seq
MIRT2602974	hsa-miR-3668	CLIP-seq
MIRT2602975	hsa-miR-3679-5p	CLIP-seq
MIRT2602976	hsa-miR-3689a-3p	CLIP-seq
MIRT2602977	hsa-miR-3689c	CLIP-seq
MIRT2602978	hsa-miR-4252	CLIP-seq
MIRT2602979	hsa-miR-4496	CLIP-seq
MIRT2602980	hsa-miR-4520a-3p	CLIP-seq
MIRT2602981	hsa-miR-4666-3p	CLIP-seq
MIRT2602982	hsa-miR-4699-5p	CLIP-seq
MIRT1270325	hsa-miR-4728-5p	CLIP-seq
MIRT2602983	hsa-miR-4732-5p	CLIP-seq
MIRT2602984	hsa-miR-491-3p	CLIP-seq
MIRT1270343	hsa-miR-561	CLIP-seq
MIRT2602985	hsa-miR-562	CLIP-seq
MIRT2602986	hsa-miR-580	CLIP-seq
MIRT2602987	hsa-miR-586	CLIP-seq
MIRT2602988	hsa-miR-941	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000502	Component	Proteasome complex	IDA	9295362, 9464850, 17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	NAS	29636472
GO:0000932	Component	P-body	IEA
GO:0000932	Component	P-body	ISS
GO:0001649	Process	Osteoblast differentiation	HDA	16210410
GO:0005515	Function	Protein binding	IPI	16189514, 16712842, 16763564, 16990800, 19490896, 21516116, 22078707, 22901813, 25416956, 26496610, 27107012, 28514442, 31515488, 32296183, 32814053, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	9295362
GO:0008540	Component	Proteasome regulatory particle, base subcomplex	IBA
GO:0016020	Component	Membrane	HDA	16210410, 19946888
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0022624	Component	Proteasome accessory complex	IEA
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0036402	Function	Proteasome-activating activity	IBA
GO:0036402	Function	Proteasome-activating activity	IDA	9295362
GO:0036402	Function	Proteasome-activating activity	TAS	9464850
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	19489727
GO:1901800	Process	Positive regulation of proteasomal protein catabolic process	IC	9464850
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
154365	9548	ENSG00000161057

P35998

Protein name

26S proteasome regulatory subunit 7 (26S proteasome AAA-ATPase subunit RPT1) (Proteasome 26S subunit ATPase 2)

Protein function

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which

PDB

5GJQ , 5GJR , 5L4G , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VGZ , 5VHF , 5VHH , 5VHI , 5VHJ , 5VHM , 5VHN , 5VHO , 5VHP , 5VHQ , 5VHR , 5VHS , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6WJD , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 7W37 , 7W38 , 7W39 , 7W3A , 7W3B , 7W3C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00004	AAA	212 → 345	ATPase family associated with various cellular activities (AAA)	Domain
PF17862	AAA_lid_3	367 → 411	AAA+ lid domain	Domain

Sequence

MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKIN
ELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAK
FVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGC
KEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRV
IGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTML
ELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHAR
SMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSY
AKFSATPRYMTYN

Sequence length

433

Interactions

View interactions

	KEGG		Reactome
	Proteasome Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Spinocerebellar ataxia Prion disease Pathways of neurodegeneration - multiple diseases Epstein-Barr virus infection		Activation of NF-kappaB in B cells Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha Cross-presentation of soluble exogenous antigens (endosomes) Autodegradation of Cdh1 by Cdh1:APC/C SCF-beta-TrCP mediated degradation of Emi1 APC/C:Cdc20 mediated degradation of Securin APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 Cdc20:Phospho-APC/C mediated degradation of Cyclin A Vpu mediated degradation of CD4 Vif-mediated degradation of APOBEC3G SCF(Skp2)-mediated degradation of p27/p21 Degradation of beta-catenin by the destruction complex Downstream TCR signaling Separation of Sister Chromatids FCERI mediated NF-kB activation Autodegradation of the E3 ubiquitin ligase COP1 Regulation of ornithine decarboxylase (ODC) ABC-family proteins mediated transport AUF1 (hnRNP D0) binds and destabilizes mRNA Asymmetric localization of PCP proteins Degradation of AXIN Degradation of DVL Hedgehog ligand biogenesis Hh mutants that don't undergo autocatalytic processing are degraded by ERAD Dectin-1 mediated noncanonical NF-kB signaling CLEC7A (Dectin-1) signaling Degradation of GLI1 by the proteasome GLI3 is processed to GLI3R by the proteasome Hedgehog 'on' state Regulation of RAS by GAPs TNFR2 non-canonical NF-kB pathway NIK-->noncanonical NF-kB signaling Defective CFTR causes cystic fibrosis MAPK6/MAPK4 signaling UCH proteinases Ub-specific processing proteases Neutrophil degranulation CDT1 association with the CDC6:ORC:origin complex Orc1 removal from chromatin CDK-mediated phosphorylation and removal of Cdc6 G2/M Checkpoints Ubiquitin Mediated Degradation of Phosphorylated Cdc25A Ubiquitin-dependent degradation of Cyclin D The role of GTSE1 in G2/M progression after G2 checkpoint FBXL7 down-regulates AURKA during mitotic entry and in early mitosis RUNX1 regulates transcription of genes involved in differentiation of HSCs Regulation of RUNX2 expression and activity Regulation of RUNX3 expression and activity Regulation of PTEN stability and activity Neddylation Interleukin-1 signaling Antigen processing: Ubiquitination & Proteasome degradation

PSMC2 (proteasome 26S subunit, ATPase 2)