Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	56998
Gene name	Catenin beta interacting protein 1
Gene symbol	CTNNBIP1
Synonyms (NCBI Gene)	ICAT
Chromosome	1
Chromosome location	1p36.22
Summary	The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for t

153

Show/Hide all (153)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000097	hsa-miR-29b-3p	Luciferase reporter assay	23478036
MIRT007364	hsa-miR-215-5p	Luciferase reporter assay	23554908
MIRT019224	hsa-miR-335-5p	Microarray	18185580
MIRT007364	hsa-miR-215-5p	Microarray	19074876
MIRT026964	hsa-miR-192-5p	Microarray	19074876
MIRT037541	hsa-miR-744-5p	CLASH	23622248
MIRT704435	hsa-miR-29a-3p	HITS-CLIP	23313552
MIRT000097	hsa-miR-29b-3p	HITS-CLIP	23313552
MIRT704434	hsa-miR-29c-3p	HITS-CLIP	23313552
MIRT704433	hsa-miR-6835-3p	HITS-CLIP	23313552
MIRT704432	hsa-miR-4422	HITS-CLIP	23313552
MIRT704431	hsa-miR-488-5p	HITS-CLIP	23313552
MIRT704430	hsa-miR-7113-5p	HITS-CLIP	23313552
MIRT704429	hsa-miR-4685-5p	HITS-CLIP	23313552
MIRT704428	hsa-miR-6837-5p	HITS-CLIP	23313552
MIRT704427	hsa-miR-5091	HITS-CLIP	23313552
MIRT704426	hsa-miR-5739	HITS-CLIP	23313552
MIRT704425	hsa-miR-4786-3p	HITS-CLIP	23313552
MIRT704424	hsa-miR-2115-5p	HITS-CLIP	23313552
MIRT704423	hsa-miR-671-5p	HITS-CLIP	23313552
MIRT659275	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT659274	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT659273	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT659272	hsa-miR-3180-5p	HITS-CLIP	23824327
MIRT734344	hsa-miR-296-3p	Luciferase reporter assayqRT-PCRWestern blotting	32323769
MIRT007364	hsa-miR-215-5p	qRT-PCR	33255928
MIRT704435	hsa-miR-29a-3p	HITS-CLIP	23313552
MIRT000097	hsa-miR-29b-3p	HITS-CLIP	23313552
MIRT704434	hsa-miR-29c-3p	HITS-CLIP	23313552
MIRT704433	hsa-miR-6835-3p	HITS-CLIP	23313552
MIRT704432	hsa-miR-4422	HITS-CLIP	23313552
MIRT704431	hsa-miR-488-5p	HITS-CLIP	23313552
MIRT704430	hsa-miR-7113-5p	HITS-CLIP	23313552
MIRT704429	hsa-miR-4685-5p	HITS-CLIP	23313552
MIRT704428	hsa-miR-6837-5p	HITS-CLIP	23313552
MIRT704427	hsa-miR-5091	HITS-CLIP	23313552
MIRT704426	hsa-miR-5739	HITS-CLIP	23313552
MIRT704425	hsa-miR-4786-3p	HITS-CLIP	23313552
MIRT704424	hsa-miR-2115-5p	HITS-CLIP	23313552
MIRT704423	hsa-miR-671-5p	HITS-CLIP	23313552
MIRT659275	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT659274	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT659273	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT659272	hsa-miR-3180-5p	HITS-CLIP	23824327
MIRT704435	hsa-miR-29a-3p	Western blottingqRT-PCR	38967721
MIRT915006	hsa-miR-1202	CLIP-seq
MIRT915007	hsa-miR-1294	CLIP-seq
MIRT915008	hsa-miR-1343	CLIP-seq
MIRT915009	hsa-miR-1915	CLIP-seq
MIRT915010	hsa-miR-1976	CLIP-seq
MIRT915011	hsa-miR-2355-5p	CLIP-seq
MIRT915012	hsa-miR-24	CLIP-seq
MIRT915013	hsa-miR-2861	CLIP-seq
MIRT915014	hsa-miR-3157-5p	CLIP-seq
MIRT915015	hsa-miR-3194-5p	CLIP-seq
MIRT915016	hsa-miR-3197	CLIP-seq
MIRT915017	hsa-miR-320e	CLIP-seq
MIRT915018	hsa-miR-3972	CLIP-seq
MIRT915019	hsa-miR-4283	CLIP-seq
MIRT915020	hsa-miR-4286	CLIP-seq
MIRT915021	hsa-miR-4312	CLIP-seq
MIRT915022	hsa-miR-4316	CLIP-seq
MIRT915023	hsa-miR-4323	CLIP-seq
MIRT915024	hsa-miR-4437	CLIP-seq
MIRT915025	hsa-miR-4523	CLIP-seq
MIRT915026	hsa-miR-4677-3p	CLIP-seq
MIRT915027	hsa-miR-4691-3p	CLIP-seq
MIRT915028	hsa-miR-4758-3p	CLIP-seq
MIRT915029	hsa-miR-125a-5p	CLIP-seq
MIRT915030	hsa-miR-125b	CLIP-seq
MIRT915008	hsa-miR-1343	CLIP-seq
MIRT915010	hsa-miR-1976	CLIP-seq
MIRT915013	hsa-miR-2861	CLIP-seq
MIRT915031	hsa-miR-3120-3p	CLIP-seq
MIRT915032	hsa-miR-3153	CLIP-seq
MIRT915017	hsa-miR-320e	CLIP-seq
MIRT915021	hsa-miR-4312	CLIP-seq
MIRT915033	hsa-miR-4319	CLIP-seq
MIRT915034	hsa-miR-4645-5p	CLIP-seq
MIRT915035	hsa-miR-4673	CLIP-seq
MIRT915036	hsa-miR-4706	CLIP-seq
MIRT915037	hsa-miR-4740-3p	CLIP-seq
MIRT915038	hsa-miR-4749-5p	CLIP-seq
MIRT915039	hsa-miR-4781-5p	CLIP-seq
MIRT915040	hsa-miR-4802-5p	CLIP-seq
MIRT915041	hsa-miR-659	CLIP-seq
MIRT1971419	hsa-miR-143	CLIP-seq
MIRT1971420	hsa-miR-192	CLIP-seq
MIRT1971421	hsa-miR-2115	CLIP-seq
MIRT1971422	hsa-miR-215	CLIP-seq
MIRT1971423	hsa-miR-29a	CLIP-seq
MIRT1971424	hsa-miR-29b	CLIP-seq
MIRT1971425	hsa-miR-29c	CLIP-seq
MIRT1971426	hsa-miR-3129-3p	CLIP-seq
MIRT1971427	hsa-miR-342-3p	CLIP-seq
MIRT1971428	hsa-miR-3661	CLIP-seq
MIRT1971429	hsa-miR-3664-3p	CLIP-seq
MIRT1971430	hsa-miR-377	CLIP-seq
MIRT1971431	hsa-miR-4254	CLIP-seq
MIRT1971432	hsa-miR-4505	CLIP-seq
MIRT915034	hsa-miR-4645-5p	CLIP-seq
MIRT915035	hsa-miR-4673	CLIP-seq
MIRT1971433	hsa-miR-4731-5p	CLIP-seq
MIRT1971434	hsa-miR-4770	CLIP-seq
MIRT1971435	hsa-miR-486-3p	CLIP-seq
MIRT1971436	hsa-miR-619	CLIP-seq
MIRT1971437	hsa-miR-631	CLIP-seq
MIRT2207006	hsa-miR-4705	CLIP-seq
MIRT2207007	hsa-miR-922	CLIP-seq
MIRT2207008	hsa-miR-1184	CLIP-seq
MIRT2207009	hsa-miR-1234	CLIP-seq
MIRT2207010	hsa-miR-1256	CLIP-seq
MIRT2207011	hsa-miR-145	CLIP-seq
MIRT2207012	hsa-miR-214	CLIP-seq
MIRT2207013	hsa-miR-23a	CLIP-seq
MIRT2207014	hsa-miR-23b	CLIP-seq
MIRT2207015	hsa-miR-23c	CLIP-seq
MIRT2207016	hsa-miR-3074-3p	CLIP-seq
MIRT2207017	hsa-miR-3619-5p	CLIP-seq
MIRT2207018	hsa-miR-412	CLIP-seq
MIRT2207019	hsa-miR-4291	CLIP-seq
MIRT2207020	hsa-miR-4503	CLIP-seq
MIRT2207006	hsa-miR-4705	CLIP-seq
MIRT2207021	hsa-miR-4743	CLIP-seq
MIRT2207022	hsa-miR-761	CLIP-seq
MIRT2207007	hsa-miR-922	CLIP-seq
MIRT2447773	hsa-miR-125a-3p	CLIP-seq
MIRT915032	hsa-miR-3153	CLIP-seq
MIRT2447774	hsa-miR-3156-3p	CLIP-seq
MIRT2447775	hsa-miR-4251	CLIP-seq
MIRT2447776	hsa-miR-4301	CLIP-seq
MIRT2447777	hsa-miR-4303	CLIP-seq
MIRT2447778	hsa-miR-4329	CLIP-seq
MIRT2447779	hsa-miR-4668-5p	CLIP-seq
MIRT2447780	hsa-miR-513a-5p	CLIP-seq
MIRT2447781	hsa-miR-552	CLIP-seq
MIRT915041	hsa-miR-659	CLIP-seq
MIRT2447773	hsa-miR-125a-3p	CLIP-seq
MIRT915032	hsa-miR-3153	CLIP-seq
MIRT2447779	hsa-miR-4668-5p	CLIP-seq
MIRT2447780	hsa-miR-513a-5p	CLIP-seq
MIRT2447781	hsa-miR-552	CLIP-seq
MIRT2678760	hsa-miR-1200	CLIP-seq
MIRT2678761	hsa-miR-1266	CLIP-seq
MIRT2678762	hsa-miR-1273f	CLIP-seq
MIRT1971419	hsa-miR-143	CLIP-seq
MIRT1971429	hsa-miR-3664-3p	CLIP-seq
MIRT2678763	hsa-miR-4324	CLIP-seq
MIRT2678764	hsa-miR-4518	CLIP-seq
MIRT2678765	hsa-miR-4708-5p	CLIP-seq
MIRT2678766	hsa-miR-4722-3p	CLIP-seq
MIRT1971434	hsa-miR-4770	CLIP-seq
MIRT2678767	hsa-miR-544b	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
E2F1	Activation	21532622

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	11751639
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0001223	Function	Transcription coactivator binding	IPI	11751639
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0002528	Process	Regulation of vascular permeability involved in acute inflammatory response	IMP	18287330
GO:0005515	Function	Protein binding	IPI	12408824, 12408825, 16189514, 16293619, 17510365, 18287330, 20211142, 21885566, 25416956, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	18287330, 19569129
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	19569129
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	18287330
GO:0008013	Function	Beta-catenin binding	IBA
GO:0008013	Function	Beta-catenin binding	IEA
GO:0008013	Function	Beta-catenin binding	IPI	12408825, 18287330
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IBA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA
GO:0030877	Component	Beta-catenin destruction complex	IBA
GO:0030877	Component	Beta-catenin destruction complex	IDA	16188939
GO:0031333	Process	Negative regulation of protein-containing complex assembly	IDA	11751639
GO:0032991	Component	Protein-containing complex	IEA
GO:0045657	Process	Positive regulation of monocyte differentiation	IMP	19569129
GO:0045669	Process	Positive regulation of osteoblast differentiation	IMP	18977368
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	12408825
GO:0060633	Process	Negative regulation of transcription initiation by RNA polymerase II	IDA	11751639
GO:0070016	Function	Armadillo repeat domain binding	IPI	12408825
GO:0072201	Process	Negative regulation of mesenchymal cell proliferation	IMP	18977368
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	11751639
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	18977368
GO:0140416	Function	Transcription regulator inhibitor activity	IDA	11751639
GO:1990711	Component	Beta-catenin-ICAT complex	IEA

MIM	HGNC	e!Ensembl
607758	16913	ENSG00000178585

Q9NSA3

Protein name

Beta-catenin-interacting protein 1 (Inhibitor of beta-catenin and Tcf-4)

Protein function

Prevents the interaction between CTNNB1 and TCF family members, and acts as a negative regulator of the Wnt signaling pathway.

PDB

1LUJ , 1M1E , 1T08

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06384	ICAT	1 → 79	Beta-catenin-interacting protein ICAT	Family

Sequence

MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSI
DQGAEDVVMAFSRSETEDRRQ

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Wnt signaling pathway		Deactivation of the beta-catenin transactivating complex

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (19)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Inhibit	27208794	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	40571311	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	27208794, 36036768, 37530655	★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Dystrophy Crystalline of Schnyder	Associate	16163269	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Associate	35045206	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis	Inhibit	26997628	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	32323769	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	26317904, 32323769	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Inhibit	26997628	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laminopathies	Associate	35045206	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Inhibit	35984200	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	31766223	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	28273108	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	31766223	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Associate	40389469	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Associate	38404150	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	21885566	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	27208794	★★★★★ ★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Associate	35045206	★★★★★ ★☆☆☆☆ Found in Text Mining only

CTNNBIP1 (catenin beta interacting protein 1)