Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
56997
Gene name Gene Name - the full gene name approved by the HGNC.
Coenzyme Q8A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
COQ8A
Synonyms (NCBI Gene) Gene synonyms aliases
ADCK3, ARCA2, CABC1, COQ10D4, COQ8, SCAR9
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q42.13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a mitochondrial protein similar to yeast ABC1, which functions in an electron-transferring membrane protein complex in the respiratory chain. It is not related to the family of ABC transporter proteins. Expression of this gene is induced
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs74589348 C>G,T Uncertain-significance, likely-benign, conflicting-interpretations-of-pathogenicity, benign Coding sequence variant, synonymous variant
rs119468004 G>A,C Pathogenic Missense variant, coding sequence variant
rs119468005 C>G,T Likely-pathogenic, pathogenic Missense variant, coding sequence variant
rs119468006 G>A,T Pathogenic Missense variant, coding sequence variant
rs119468008 A>G Pathogenic Missense variant, coding sequence variant
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0004672 Function Protein kinase activity IDA 27499294
GO:0004672 Function Protein kinase activity ISS
GO:0005515 Function Protein binding IPI 16189514, 25416956, 25910212, 27499296, 31515488, 32296183, 32814053
GO:0005524 Function ATP binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606980 16812 ENSG00000163050
Protein
UniProt ID Q8NI60
Protein name Atypical kinase COQ8A, mitochondrial (EC 2.7.-.-) (Chaperone activity of bc1 complex-like) (Chaperone-ABC1-like) (Coenzyme Q protein 8A) (aarF domain-containing protein kinase 3)
Protein function Atypical kinase involved in the biosynthesis of coenzyme Q, also named ubiquinone, an essential lipid-soluble electron transporter for aerobic cellular respiration (PubMed:21296186, PubMed:25498144, PubMed:25540914, PubMed:27499294, PubMed:36302
PDB 4PED , 5I35 , 7UDP , 7UDQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03109 ABC1 318 434 ABC1 family Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed, with highest levels in adrenal gland, heart, pancreas, nasal mucosa, stomach, uterus and skeletal muscle. {ECO:0000269|PubMed:24270420}.
Sequence
MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQG
QDKHEEYFAENFGGPEGEFHFSVPHAAGASTDFSSASAPDQSAPPSLGHAHSEGPAPAYV
ASGPFREAGFPGQASSPLGRANGRLFANPRDSFSAMGFQRRFFHQDQSPVGGLTAEDIEK
ARQAKARPENKQHKQTLSEHARERKVPVTRIGRLANFGGLAVGLGFGALAEVAKKSLRSE
DPSGKKAVLGSSPFLSEANAERIVRTLCKVRGAALKLGQMLSIQDDAFINPHLAKIFERV
RQSADFMPLKQMMKTLNNDLGPNWRDKLEYFEERPFAAASIGQVHLARMKGGREVAMKIQ
YPGVAQSINSDVNNLMAVLNMSNMLPEGLFPEHLIDVLRRELALECDYQREAACARKFRD
LLKGHPFFYVPEIV
DELCSPHVLTTELVSGFPLDQAEGLSQEIRNEICYNILVLCLRELF
EFHFMQTDPNWSNFFYDPQQHKVALLDFGATREYDRSFTDLYIQIIRAAADRDRETVRAK
SIEMKFLTGYEVKVMEDAHLDAILILGEAFASDEPFDFGTQSTTEKIHNLIPVMLRHRLV
PPPEETYSLHRKMGGSFLICSKLKARFPCKAMFEEAYSNYCKRQAQQ
Sequence length 647
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Ataxia autosomal recessive ataxia due to ubiquinone deficiency rs764847439, rs748118737, rs119468005, rs1271428051, rs771578775, rs781518112, rs119468006, rs1572040505, rs767406263, rs387906298, rs755933881, rs140246430, rs1659738028, rs606231138, rs199874519
View all (17 more)
N/A
Coenzyme Q10 deficiency coenzyme q10 deficiency, primary, 1 rs1558212305 N/A
Developmental Delay global developmental delay rs753254213 N/A
Fatal Mitochondrial Disease Mitochondrial disease rs755933881, rs1572079834 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Cerebellar Ataxia Autosomal recessive cerebellar ataxia N/A N/A ClinVar
Joubert Syndrome joubert syndrome 17 N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Anorchia Associate 35275351
Aphasia Broca Associate 24164873
Ataxia Associate 21873089, 24164873, 26866375, 29915382, 32337771
Ataxia Telangiectasia Like Disorder Associate 29915382
Cerebellar Ataxia Associate 18319072, 24218524, 25216398, 26818466, 32743982, 34663476
Cerebellar Diseases Associate 18319072, 24164873, 35275351
Coenzyme Q10 Deficiency Associate 18319072, 24164873, 24218524, 25216398, 26818466, 32743982
Coenzyme Q10 Deficiency Stimulate 19096106, 32830305
Cognition Disorders Associate 32337771
Dementia Associate 36421848