Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	56984
Gene name	Proteasome assembly chaperone 2
Gene symbol	PSMG2
Synonyms (NCBI Gene)	CLAST3HCCA3HsT1707MDS003PAC2PRAAS4TNFSF5IP1
Chromosome	18
Chromosome location	18p11.21

Show/Hide all (56)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051798	hsa-let-7c-5p	CLASH	23622248
MIRT048483	hsa-miR-100-5p	CLASH	23622248
MIRT079715	hsa-miR-548ag	PAR-CLIP	20371350
MIRT079716	hsa-miR-548ai	PAR-CLIP	20371350
MIRT079717	hsa-miR-548ba	PAR-CLIP	20371350
MIRT079710	hsa-miR-570-5p	PAR-CLIP	20371350
MIRT079711	hsa-miR-595	PAR-CLIP	20371350
MIRT514330	hsa-miR-503-3p	PAR-CLIP	20371350
MIRT514329	hsa-miR-2052	PAR-CLIP	20371350
MIRT514328	hsa-miR-19a-5p	PAR-CLIP	20371350
MIRT514327	hsa-miR-19b-1-5p	PAR-CLIP	20371350
MIRT514326	hsa-miR-19b-2-5p	PAR-CLIP	20371350
MIRT079712	hsa-miR-1225-5p	PAR-CLIP	20371350
MIRT079713	hsa-miR-1229-5p	PAR-CLIP	20371350
MIRT079715	hsa-miR-548ag	PAR-CLIP	23446348
MIRT079716	hsa-miR-548ai	PAR-CLIP	23446348
MIRT079717	hsa-miR-548ba	PAR-CLIP	23446348
MIRT079710	hsa-miR-570-5p	PAR-CLIP	23446348
MIRT079711	hsa-miR-595	PAR-CLIP	23446348
MIRT514330	hsa-miR-503-3p	PAR-CLIP	23446348
MIRT514329	hsa-miR-2052	PAR-CLIP	23446348
MIRT514328	hsa-miR-19a-5p	PAR-CLIP	23446348
MIRT514327	hsa-miR-19b-1-5p	PAR-CLIP	23446348
MIRT514326	hsa-miR-19b-2-5p	PAR-CLIP	23446348
MIRT079712	hsa-miR-1225-5p	PAR-CLIP	23446348
MIRT079713	hsa-miR-1229-5p	PAR-CLIP	23446348
MIRT079715	hsa-miR-548ag	PAR-CLIP	20371350
MIRT079716	hsa-miR-548ai	PAR-CLIP	20371350
MIRT079717	hsa-miR-548ba	PAR-CLIP	20371350
MIRT079710	hsa-miR-570-5p	PAR-CLIP	20371350
MIRT079711	hsa-miR-595	PAR-CLIP	20371350
MIRT514330	hsa-miR-503-3p	PAR-CLIP	20371350
MIRT514329	hsa-miR-2052	PAR-CLIP	20371350
MIRT514328	hsa-miR-19a-5p	PAR-CLIP	20371350
MIRT514327	hsa-miR-19b-1-5p	PAR-CLIP	20371350
MIRT514326	hsa-miR-19b-2-5p	PAR-CLIP	20371350
MIRT079712	hsa-miR-1225-5p	PAR-CLIP	20371350
MIRT079713	hsa-miR-1229-5p	PAR-CLIP	20371350
MIRT079715	hsa-miR-548ag	PAR-CLIP	23446348
MIRT079716	hsa-miR-548ai	PAR-CLIP	23446348
MIRT079717	hsa-miR-548ba	PAR-CLIP	23446348
MIRT079710	hsa-miR-570-5p	PAR-CLIP	23446348
MIRT079711	hsa-miR-595	PAR-CLIP	23446348
MIRT514330	hsa-miR-503-3p	PAR-CLIP	23446348
MIRT514329	hsa-miR-2052	PAR-CLIP	23446348
MIRT514328	hsa-miR-19a-5p	PAR-CLIP	23446348
MIRT514327	hsa-miR-19b-1-5p	PAR-CLIP	23446348
MIRT514326	hsa-miR-19b-2-5p	PAR-CLIP	23446348
MIRT079712	hsa-miR-1225-5p	PAR-CLIP	23446348
MIRT079713	hsa-miR-1229-5p	PAR-CLIP	23446348
MIRT1271031	hsa-miR-3145-3p	CLIP-seq
MIRT1271032	hsa-miR-4318	CLIP-seq
MIRT1271033	hsa-miR-4693-5p	CLIP-seq
MIRT1271034	hsa-miR-4699-3p	CLIP-seq
MIRT1271035	hsa-miR-892a	CLIP-seq
MIRT2306047	hsa-miR-3163	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16251969, 25416956, 32296183, 33961781, 35271311, 35914814
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0007094	Process	Mitotic spindle assembly checkpoint signaling	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043248	Process	Proteasome assembly	IBA
GO:0051131	Process	Chaperone-mediated protein complex assembly	IDA	16251969
GO:0051131	Process	Chaperone-mediated protein complex assembly	IGI	17189198
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0060090	Function	Molecular adaptor activity	IGI	17189198
GO:0101031	Component	Protein folding chaperone complex	IDA	16251969

MIM	HGNC	e!Ensembl
609702	24929	ENSG00000128789

Q969U7

Protein name

Proteasome assembly chaperone 2 (PAC-2) (Hepatocellular carcinoma-susceptibility protein 3) (Tumor necrosis factor superfamily member 5-induced protein 1)

Protein function

Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG1. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the hetero

PDB

8QYJ , 8QYL , 8QYM , 8QYN , 8QYS , 8QZ9 , 8TM3 , 8TM4 , 8TM5 , 8TM6 , 8YIX , 8YIY , 8YIZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09754	PAC2	17 → 228	PAC2 family	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with highest levels in lung, brain and colon. Moderately expressed in muscle, stomach, spleen and heart. Weakly expressed in small intestine, pancreas and liver. Highly expressed in hepatocellular carcinomas with low l

Sequence

MFVPCGESAPDLAGFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNP
YATTEGNSTELSINAEVYSLPSRKLVALQLRSIFIKYKSKPFCEKLLSWVKSSGCARVIV
LSSSHSYQRNDLQLRSTPFRYLLTPSMQKSVQNKIKSLNWEEMEKSRCIPEIDDSEFCIR
IPGGGITKTLYDESCSKEIQMAVLLKFVSEGDNIPDALGLVEYLNEWLQILKPLSDDPTV
SASRWKIPSSWRLLFGSGLPPALF

Sequence length

264

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Proteasome-associated autoinflammatory syndrome 4	Pathogenic	rs2040458488	RCV001291936	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cervical cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSMG2-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Aicardi Goutieres syndrome	Associate	31874111	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	11854909	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Autoinflammatory Diseases	Associate	30664889	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	11854909	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	11854909	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	36707884	★★★★★ ★☆☆☆☆ Found in Text Mining only

PSMG2 (proteasome assembly chaperone 2)