Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
56971
Gene name Gene Name - the full gene name approved by the HGNC.
CEA cell adhesion molecule 19
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CEACAM19
Synonyms (NCBI Gene) Gene synonyms aliases
CEACM19, CEAL1
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.31
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT882943 hsa-miR-1253 CLIP-seq
MIRT882944 hsa-miR-153 CLIP-seq
MIRT882945 hsa-miR-2110 CLIP-seq
MIRT882946 hsa-miR-2355-3p CLIP-seq
MIRT882947 hsa-miR-2861 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 20374249
GO:0016020 Component Membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606691 31951 ENSG00000186567
Protein
UniProt ID Q7Z692
Protein name Cell adhesion molecule CEACAM19 (Carcinoembryonic antigen-like 1) (Carcinoembryonic antigen-related cell adhesion molecule 19) (CEA cell adhesion molecule 19)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 22 141 Immunoglobulin V-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous with highest expression in prostate, uterus, fetal brain, mammary gland, adrenal gland, skeletal muscle, small intestine, and kidney, and lower expression in lung, cerebellum, testis, liver, pancreas, bone marrow and ovary.
Sequence
MEIPMGTQGCFSKSLLLSASILVLWMLQGSQAALYIQKIPEQPQKNQDLLLSVQGVPDTF
QDFNWYLGEETYGGTRLFTYIPGIQRPQRDGSAMGQRDIVGFPNGSMLLRRAQPTDSGTY
QVAITINSEWTMKAKTEVQVA
EKNKELPSTHLPTNAGILAATIIGSLAAGALLISCIAYL
LVTRNWRGQSHRLPAPRGQGSLSILCSAVSPVPSVTPSTWMATTEKPELGPAHDAGDNNI
YEVMPSPVLLVSPISDTRSINPARPLPTPPHLQAEPENHQYQQDLLNPDPAPYCQLVPTS
Sequence length 300
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 23099808
Alzheimer Disease Associate 33947463
Head and Neck Neoplasms Associate 36010616
Hereditary Breast and Ovarian Cancer Syndrome Associate 32659328
Ovarian Neoplasms Stimulate 32659328