PYY (peptide YY)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 5697
Gene name Peptide YY
Gene symbol PYY
Synonyms (NCBI Gene)
PYY-IPYY1
Chromosome 17
Chromosome location 17q21.31
Summary This gene encodes a member of the neuropeptide Y (NPY) family of peptides. The encoded preproprotein is proteolytically processed to generate two alternative peptide products that differ in length by three amino acids. These peptides, secreted by endocrin
miRNA miRNA information provided by mirtarbase database.
23
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (23)
miRTarBase ID miRNA Experiments Reference
MIRT1552826 hsa-miR-4314 CLIP-seq
MIRT1552827 hsa-miR-4667-5p CLIP-seq
MIRT1552828 hsa-miR-4700-5p CLIP-seq
MIRT1552829 hsa-miR-615-5p CLIP-seq
MIRT1552830 hsa-miR-637 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (13)
GO ID Ontology Definition Evidence Reference
GO:0001664 Function G protein-coupled receptor binding IPI 7493937, 7592911
GO:0005179 Function Hormone activity IEA
GO:0005179 Function Hormone activity TAS 10698177
GO:0005184 Function Neuropeptide hormone activity IBA
GO:0005515 Function Protein binding IPI 23597562
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
600781 9748 ENSG00000131096
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P10082
Protein name Peptide YY (PYY) (PYY-I) (Peptide tyrosine tyrosine) [Cleaved into: Peptide YY(3-36) (PYY-II)]
Protein function This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
PDB 2DEZ , 2DF0 , 2L60 , 2NA5 , 7RT9 , 7YON
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00159 Hormone_3 30 → 64 Pancreatic hormone peptide Family
Sequence 
MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPREDASPEELNRYYASLRHYLNLVT
RQRYGKRDGPDTLLSKTFFPDGEDRPVRSRSEGPDLW
Sequence length 97
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Neuroactive ligand-receptor interaction   Peptide ligand-binding receptors
G alpha (i) signalling events
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Obesity Uncertain significance rs267606994 RCV000033193
Show/Hide Text Mining Associations (22)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 29070909
Arthritis Rheumatoid Associate 34239365
Cardio Renal Syndrome Associate 19820027
Colonic Neoplasms Inhibit 3374119
Colorectal Neoplasms Associate 32058945, 32462020, 32797167, 34796980
Crohn Disease Associate 19956723
Diabetes Mellitus Inhibit 26734798
Diabetes Mellitus Associate 29311617
Failure to Thrive Associate 15754036
Feeding and Eating Disorders Stimulate 27264721