PYY (peptide YY)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5697
Gene name Gene Name - the full gene name approved by the HGNC.
Peptide YY
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PYY
Synonyms (NCBI Gene) Gene synonyms aliases
PYY-I, PYY1
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the neuropeptide Y (NPY) family of peptides. The encoded preproprotein is proteolytically processed to generate two alternative peptide products that differ in length by three amino acids. These peptides, secreted by endocrin
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(23)
miRTarBase ID miRNA Experiments Reference
MIRT1552826 hsa-miR-4314 CLIP-seq
MIRT1552827 hsa-miR-4667-5p CLIP-seq
MIRT1552828 hsa-miR-4700-5p CLIP-seq
MIRT1552829 hsa-miR-615-5p CLIP-seq
MIRT1552830 hsa-miR-637 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
GO ID Ontology Definition Evidence Reference
GO:0001664 Function G protein-coupled receptor binding IPI 7493937, 7592911
GO:0005179 Function Hormone activity IEA
GO:0005179 Function Hormone activity TAS 10698177
GO:0005184 Function Neuropeptide hormone activity IBA
GO:0005515 Function Protein binding IPI 23597562
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
600781 9748 ENSG00000131096
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P10082
Protein name Peptide YY (PYY) (PYY-I) (Peptide tyrosine tyrosine) [Cleaved into: Peptide YY(3-36) (PYY-II)]
Protein function This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
PDB 2DEZ , 2DF0 , 2L60 , 2NA5 , 7RT9 , 7YON
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00159 Hormone_3 30 → 64 Pancreatic hormone peptide Family
Sequence 
MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPREDASPEELNRYYASLRHYLNLVT
RQRYGKRDGPDTLLSKTFFPDGEDRPVRSRSEGPDLW
Sequence length 97
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Neuroactive ligand-receptor interaction   Peptide ligand-binding receptors
G alpha (i) signalling events
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Obesity obesity N/A N/A ClinVar
Show/Hide Text Mining Associations (22)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 29070909
Arthritis Rheumatoid Associate 34239365
Cardio Renal Syndrome Associate 19820027
Colonic Neoplasms Inhibit 3374119
Colorectal Neoplasms Associate 32058945, 32462020, 32797167, 34796980
Crohn Disease Associate 19956723
Diabetes Mellitus Inhibit 26734798
Diabetes Mellitus Associate 29311617
Failure to Thrive Associate 15754036
Feeding and Eating Disorders Stimulate 27264721