Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
56955
Gene name Gene Name - the full gene name approved by the HGNC.
Matrix extracellular phosphoglycoprotein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MEPE
Synonyms (NCBI Gene) Gene synonyms aliases
OF45
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a secreted calcium-binding phosphoprotein that belongs to the small integrin-binding ligand, N-linked glycoprotein (SIBLING) family of proteins. Members of this family are components of the extracellular matrix of bone and dentin and reg
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017419 hsa-miR-335-5p Microarray 18185580
MIRT022428 hsa-miR-124-3p Microarray 18668037
MIRT437788 hsa-miR-376a-3p HepG2" 23570370
MIRT2270420 hsa-miR-181a CLIP-seq
MIRT2270421 hsa-miR-181b CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001501 Process Skeletal system development TAS 10945470
GO:0005201 Function Extracellular matrix structural constituent TAS 10945470
GO:0005515 Function Protein binding IPI 15664000, 17474147, 32296183
GO:0005576 Component Extracellular region IEA
GO:0005788 Component Endoplasmic reticulum lumen TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605912 13361 ENSG00000152595
Protein
UniProt ID Q9NQ76
Protein name Matrix extracellular phosphoglycoprotein (Osteoblast/osteocyte factor 45) (OF45) (Osteoregulin)
Protein function Promotes renal phosphate excretion and inhibits intestinal phosphate absorption (PubMed:14962809, PubMed:19005008). Promotes bone mineralization by osteoblasts and cartilage mineralization by chondrocytes (PubMed:18162525, PubMed:19998030, PubMe
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07175 Osteoregulin 97 256 Osteoregulin Family
Tissue specificity TISSUE SPECIFICITY: Detected in urine (at protein level) (PubMed:37453717). Expressed by osteoblasts (PubMed:10945470, PubMed:11414762, PubMed:15108058). Expressed by stem cells in dental pulp (PubMed:15153459). Expressed by mesenchymal cells in dental pa
Sequence
MRVFCVGLLLFSVTWAAPTFQPQTEKTKQSCVEEQRQEEKNKDNIGFHHLGKRINQELSS
KENIVQERKKDLSLSEASENKGSSKSQNYFTNRQRLNKEYSISNKENTHNGLRMSIYPKS
TGNKGFEDGDDAISKLHDQEEYGAALIRNNMQHIMGPVTAIKLLGEENKENTPRNVLNII
PASMNYAKAHSKDKKKPQRDSQAQKSPVKSKSTHRIQHNIDYLKHLSKVKKIPSDFEGSG
YTDLQERGDNDISPFS
GDGQPFKDIPGKGEATGPDLEGKDIQTGFAGPSEAESTHLDTKK
PGYNEIPEREENGGNTIGTRDETAKEADAVDVSLVEGSNDIMGSTNFKELPGREGNRVDA
GSQNAHQGKVEFHYPPAPSKEKRKEGSSDAAESTNYNEIPKNGKGSTRKGVDHSNRNQAT
LNEKQRFPSKGKSQGLPIPSRGLDNEIKNEMDSFNGPSHENIITHGRKYHYVPHRQNNST
RNKGMPQGKGSWGRQPHSNRRFSSRRRDDSSESSDSGSSSESDGD
Sequence length 525
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  ECM-receptor interaction   Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Gout Gout N/A N/A GWAS
Osteoporosis Osteoporosis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Bone Diseases Associate 17900349, 30287925
Bone Diseases Metabolic Associate 24747200
Cardiovascular Diseases Associate 21779381
Cerebral Infarction Associate 21779381
Chronic Kidney Disease Mineral and Bone Disorder Associate 33097703
Craniofacial Abnormalities Associate 30287925
Dental Plaque Associate 35535576
Dentin Dysplasia Associate 23451077
Epilepsy Associate 21779381
Facial paresis hereditary congenital Associate 30287925