Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	56940
Gene name	Dual specificity phosphatase 22
Gene symbol	DUSP22
Synonyms (NCBI Gene)	JKAPJSP-1JSP1LMW-DSP2LMWDSP2MKP-xMKPXVHX
Chromosome	6
Chromosome location	6p25.3

Show/Hide all (59)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019217	hsa-miR-335-5p	Microarray	18185580
MIRT030306	hsa-miR-26b-5p	Microarray	19088304
MIRT658847	hsa-miR-6856-3p	HITS-CLIP	23824327
MIRT658846	hsa-miR-449b-3p	HITS-CLIP	23824327
MIRT658845	hsa-miR-4691-3p	HITS-CLIP	23824327
MIRT658844	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT658843	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT658842	hsa-miR-139-5p	HITS-CLIP	23824327
MIRT658841	hsa-miR-4497	HITS-CLIP	23824327
MIRT658840	hsa-miR-1180-3p	HITS-CLIP	23824327
MIRT658839	hsa-miR-4664-3p	HITS-CLIP	23824327
MIRT658847	hsa-miR-6856-3p	HITS-CLIP	23824327
MIRT658846	hsa-miR-449b-3p	HITS-CLIP	23824327
MIRT658845	hsa-miR-4691-3p	HITS-CLIP	23824327
MIRT658844	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT658843	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT658842	hsa-miR-139-5p	HITS-CLIP	23824327
MIRT658841	hsa-miR-4497	HITS-CLIP	23824327
MIRT658840	hsa-miR-1180-3p	HITS-CLIP	23824327
MIRT658839	hsa-miR-4664-3p	HITS-CLIP	23824327
MIRT2215813	hsa-miR-4756-3p	CLIP-seq
MIRT2387154	hsa-miR-548aa	CLIP-seq
MIRT2520030	hsa-miR-1226	CLIP-seq
MIRT2520031	hsa-miR-1271	CLIP-seq
MIRT2520032	hsa-miR-182	CLIP-seq
MIRT2520033	hsa-miR-186	CLIP-seq
MIRT2520034	hsa-miR-29a	CLIP-seq
MIRT2520035	hsa-miR-29b	CLIP-seq
MIRT2520036	hsa-miR-29c	CLIP-seq
MIRT2520037	hsa-miR-3065-3p	CLIP-seq
MIRT2520038	hsa-miR-3133	CLIP-seq
MIRT2520039	hsa-miR-3140-3p	CLIP-seq
MIRT2520040	hsa-miR-3168	CLIP-seq
MIRT2520041	hsa-miR-362-5p	CLIP-seq
MIRT2520042	hsa-miR-3664-5p	CLIP-seq
MIRT2520043	hsa-miR-3936	CLIP-seq
MIRT2520044	hsa-miR-4450	CLIP-seq
MIRT2520045	hsa-miR-450b-5p	CLIP-seq
MIRT2520046	hsa-miR-4519	CLIP-seq
MIRT2520047	hsa-miR-4639-5p	CLIP-seq
MIRT2520048	hsa-miR-4668-5p	CLIP-seq
MIRT2520049	hsa-miR-4744	CLIP-seq
MIRT2520050	hsa-miR-4753-3p	CLIP-seq
MIRT2520051	hsa-miR-4768-5p	CLIP-seq
MIRT2520052	hsa-miR-4781-3p	CLIP-seq
MIRT2520053	hsa-miR-491-5p	CLIP-seq
MIRT2520054	hsa-miR-500b	CLIP-seq
MIRT2520055	hsa-miR-501-5p	CLIP-seq
MIRT2520056	hsa-miR-513c	CLIP-seq
MIRT2520057	hsa-miR-514b-5p	CLIP-seq
MIRT2520058	hsa-miR-618	CLIP-seq
MIRT2520059	hsa-miR-629	CLIP-seq
MIRT2520060	hsa-miR-885-3p	CLIP-seq
MIRT2520061	hsa-miR-96	CLIP-seq
MIRT2520043	hsa-miR-3936	CLIP-seq
MIRT2520044	hsa-miR-4450	CLIP-seq
MIRT2520046	hsa-miR-4519	CLIP-seq
MIRT2520048	hsa-miR-4668-5p	CLIP-seq
MIRT2520053	hsa-miR-491-5p	CLIP-seq

Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	16636663
GO:0002376	Process	Immune system process	IEA
GO:0002710	Process	Negative regulation of T cell mediated immunity	IEA
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA
GO:0004725	Function	Protein tyrosine phosphatase activity	IDA	24714587
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0004726	Function	Non-membrane spanning protein tyrosine phosphatase activity	IDA	20018849
GO:0005737	Component	Cytoplasm	IDA	20018849
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	24714587
GO:0007162	Process	Negative regulation of cell adhesion	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IBA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0008138	Function	Protein tyrosine/serine/threonine phosphatase activity	IDA	38225265
GO:0016787	Function	Hydrolase activity	IEA
GO:0030292	Function	Protein tyrosine kinase inhibitor activity	IDA	20018849
GO:0030336	Process	Negative regulation of cell migration	IMP	20018849
GO:0031941	Component	Filamentous actin	IDA	20018849
GO:0035556	Process	Intracellular signal transduction	IDA	20018849
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IBA
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0050852	Process	T cell receptor signaling pathway	IDA	8943371
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IDA	38225265
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IDA	38225265
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IEA
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IEA
GO:0050862	Process	Positive regulation of T cell receptor signaling pathway	IDA	38225265
GO:0050868	Process	Negative regulation of T cell activation	IEA
GO:0051895	Process	Negative regulation of focal adhesion assembly	IDA	20018849
GO:0061851	Component	Leading edge of lamellipodium	IDA	20018849
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	38225265
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	38225265
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IDA	20018849
GO:1990782	Function	Protein tyrosine kinase binding	IEA
GO:1990782	Function	Protein tyrosine kinase binding	IPI	24714587

MIM	HGNC	e!Ensembl
616778	16077	ENSG00000112679

Q9NRW4

Protein name

Dual specificity protein phosphatase 22 (EC 3.1.3.16) (EC 3.1.3.48) (JNK pathway associated phosphatase) (JKAP) (JNK-stimulatory phosphatase-1) (JSP-1) (Low molecular weight dual specificity phosphatase 2) (LMW-DSP2) (Mitogen-activated protein kinase phos

Protein function

Dual specificity phosphatase; can dephosphorylate both phosphotyrosine and phosphoserine or phosphothreonine residues (PubMed:24714587, PubMed:38225265). Activates the JNK signaling pathway (PubMed:11717427). Inhibits T-cell receptor signaling a

PDB

1WRM , 4WOH , 6L1S , 6LMY , 6LOT , 6LOU , 6LVQ , 7C8S

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00782	DSPc	12 → 141	Dual specificity phosphatase, catalytic domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Highest expression seen in heart, placenta, lung, liver, kidney and pancreas. {ECO:0000269|PubMed:11717427}.

Sequence

MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPS
QNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRA
GRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAF
LRRL

Sequence length

184

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
DUSP22-related disorder	Likely benign; Benign	rs777172514, rs780293262, rs202152797, rs200444409, rs369153482, rs11242812, rs759794031, rs764036547, rs763240122, rs1129085, rs755974466, rs375538067, rs56362282, rs147464089, rs148581187 View all (4 more)	RCV003897133 RCV003909394 RCV003909522 RCV003914698 RCV003929609 RCV003974451 RCV003894470 RCV003904366 RCV003981435 RCV003982345 RCV003901909 RCV003959726 RCV003917036 RCV003961496 RCV003914464 RCV003939287 RCV003969364 RCV003924205 RCV003969521

Show/Hide Text Mining Associations (40)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acquired Immunodeficiency Syndrome	Associate	31570354
Alzheimer Disease	Associate	24436131
Arthritis Rheumatoid	Associate	29287311, 33547838
Arthritis Rheumatoid	Inhibit	34811816
Autoimmune Diseases	Associate	35908771
Breast Neoplasms	Associate	17384676
Central Nervous System Diseases	Associate	34791573
Colitis Ulcerative	Inhibit	35908771
Colorectal Neoplasms	Inhibit	26032091
Crohn Disease	Inhibit	31415355, 35908771
Diabetes Mellitus	Associate	32075680
Dissection Blood Vessel	Associate	22617347
Dyskinesia Familial with Facial Myokymia	Associate	34699105
Heredodegenerative Disorders Nervous System	Associate	34289265
Inflammation	Inhibit	31415355
Inflammation	Associate	34289265, 34811816, 34918391
Inflammatory Bowel Diseases	Associate	31185018, 35018451, 35908771
Insect Bites and Stings	Associate	34622970
Leukemia Lymphocytic Chronic B Cell	Associate	28017968
Lung Injury	Associate	34918391
Lymphoma	Associate	34699105
Lymphoma Large Cell Anaplastic	Associate	24894770, 25390351, 26379151, 30093402, 31488561, 31570354, 34699105, 34791573, 35941721, 36453105
Lymphoma Primary Cutaneous Anaplastic Large Cell	Associate	22388754, 27626696, 34622970
Lymphoma T Cell	Associate	34699105
Lymphoma T Cell Peripheral	Associate	27626696
Lymphomatoid Papulosis	Associate	34699105
Lymphoproliferative Disorders	Associate	31570354
Mouth Neoplasms	Associate	28901451
Mycosis Fungoides	Associate	34699105
Neoplasms	Inhibit	26032091, 27626696, 28017968, 36017556
Neoplasms	Associate	28901451, 36453105
Neoplasms Cystic Mucinous and Serous	Associate	39198908
Obesity	Associate	32075680
Parkinson Disease	Associate	34289265
Pulmonary Disease Chronic Obstructive	Associate	34918391
Skin Neoplasms	Stimulate	30536326
Skin Neoplasms	Associate	35018451
Takayasu Arteritis	Associate	30498034
Tooth Erosion	Associate	29287311
Weight Loss	Associate	23475851

DUSP22 (dual specificity phosphatase 22)