MAP3K7CL (MAP3K7 C-terminal like)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 56911
Gene name MAP3K7 C-terminal like
Gene symbol MAP3K7CL
Synonyms (NCBI Gene)
C21orf7HC21ORF7TAK1LTAKLTAKL-1TAKL-2TAKL-4
Chromosome 21
Chromosome location 21q21.3
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT022699 hsa-miR-124-3p Microarray 18668037
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (3)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 25416956, 32296183
GO:0005634 Component Nucleus HDA 16780588
GO:0005829 Component Cytosol HDA 16780588
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
611110 16457 ENSG00000156265
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P57077
Protein name MAP3K7 C-terminal-like protein (TAK1-like protein)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Detected in lung and peripheral blood leukocytes. Expressed predominantly in peripheral blood leukocytes and ubiquitously in adult and fetal tissues. Also expressed strongly in breast carcinoma GI-101, colon adenocarcinoma GI-112, and
Sequence 
MISTARVPADKPVRIAFSLNDASDDTPPEDSIPLVFPELDQQLQPLPPCHDSEESMEVFK
QHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEALTEENRTLRLA
QSQCVEQLEKLRIQYQKRQGSS
Sequence length 142
Interactions View interactions