Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
56911
Gene name Gene Name - the full gene name approved by the HGNC.
MAP3K7 C-terminal like
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MAP3K7CL
Synonyms (NCBI Gene) Gene synonyms aliases
C21orf7, HC21ORF7, TAK1L, TAKL, TAKL-1, TAKL-2, TAKL-4
Chromosome Chromosome number
21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
21q21.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022699 hsa-miR-124-3p Microarray 18668037
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 25416956, 32296183
GO:0005634 Component Nucleus HDA 16780588
GO:0005829 Component Cytosol HDA 16780588
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611110 16457 ENSG00000156265
Protein
UniProt ID P57077
Protein name MAP3K7 C-terminal-like protein (TAK1-like protein)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Detected in lung and peripheral blood leukocytes. Expressed predominantly in peripheral blood leukocytes and ubiquitously in adult and fetal tissues. Also expressed strongly in breast carcinoma GI-101, colon adenocarcinoma GI-112, and
Sequence
MISTARVPADKPVRIAFSLNDASDDTPPEDSIPLVFPELDQQLQPLPPCHDSEESMEVFK
QHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEALTEENRTLRLA
QSQCVEQLEKLRIQYQKRQGSS
Sequence length 142
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coronary artery disease Coronary artery disease N/A N/A GWAS
Dental caries Dental caries N/A N/A GWAS
Heart Failure Heart failure N/A N/A GWAS
Hypertrophic cardiomyopathy Hypertrophic cardiomyopathy N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 22383897
Carcinoma Non Small Cell Lung Associate 33474835
Frontometaphyseal dysplasia Associate 27426733
Thyroid Neoplasms Associate 33966040