PSMA7 (proteasome 20S subunit alpha 7)

Gene

• Entrez ID: 5688
• Gene name: Proteasome 20S subunit alpha 7
• Gene symbol: PSMA7
• Synonyms (NCBI Gene): C6, HEL-S-276, HSPC, RC6-1, XAPC7
• Chromosome: 20
• Chromosome location: 20q13.33
• Summary: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT049617	hsa-miR-92a-3p	CLASH	23622248
MIRT041274	hsa-miR-193b-3p	CLASH	23622248
MIRT040706	hsa-miR-92b-3p	CLASH	23622248
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	23592263
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	23592263
MIRT456026	hsa-miR-224-3p	PAR-CLIP	23592263
MIRT456025	hsa-miR-522-3p	PAR-CLIP	23592263
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	23592263
MIRT456023	hsa-miR-4643	PAR-CLIP	23592263
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	23592263
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	23592263
MIRT456020	hsa-miR-4302	PAR-CLIP	23592263
MIRT456019	hsa-miR-1-3p	PAR-CLIP	23592263
MIRT456018	hsa-miR-206	PAR-CLIP	23592263
MIRT456017	hsa-miR-613	PAR-CLIP	23592263
MIRT456016	hsa-miR-1257	PAR-CLIP	23592263
MIRT456015	hsa-miR-466	PAR-CLIP	23592263
MIRT456014	hsa-miR-3978	PAR-CLIP	23592263
MIRT456016	hsa-miR-1257	PAR-CLIP	26701625
MIRT456016	hsa-miR-1257	PAR-CLIP	26701625
MIRT456016	hsa-miR-1257	PAR-CLIP	26701625
MIRT456016	hsa-miR-1257	PAR-CLIP	26701625
MIRT456016	hsa-miR-1257	PAR-CLIP	26701625
MIRT456016	hsa-miR-1257	PAR-CLIP	26701625
MIRT456019	hsa-miR-1-3p	PAR-CLIP	26701625
MIRT456019	hsa-miR-1-3p	PAR-CLIP	26701625
MIRT456019	hsa-miR-1-3p	PAR-CLIP	26701625
MIRT456019	hsa-miR-1-3p	PAR-CLIP	26701625
MIRT456019	hsa-miR-1-3p	PAR-CLIP	26701625
MIRT456019	hsa-miR-1-3p	PAR-CLIP	26701625
MIRT456018	hsa-miR-206	PAR-CLIP	26701625
MIRT456018	hsa-miR-206	PAR-CLIP	26701625
MIRT456018	hsa-miR-206	PAR-CLIP	26701625
MIRT456018	hsa-miR-206	PAR-CLIP	26701625
MIRT456018	hsa-miR-206	PAR-CLIP	26701625
MIRT456018	hsa-miR-206	PAR-CLIP	26701625
MIRT456026	hsa-miR-224-3p	PAR-CLIP	26701625
MIRT456026	hsa-miR-224-3p	PAR-CLIP	26701625
MIRT456026	hsa-miR-224-3p	PAR-CLIP	26701625
MIRT456026	hsa-miR-224-3p	PAR-CLIP	26701625
MIRT456026	hsa-miR-224-3p	PAR-CLIP	26701625
MIRT456026	hsa-miR-224-3p	PAR-CLIP	26701625
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	26701625
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	26701625
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	26701625
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	26701625
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	26701625
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	26701625
MIRT456014	hsa-miR-3978	PAR-CLIP	26701625
MIRT456014	hsa-miR-3978	PAR-CLIP	26701625
MIRT456014	hsa-miR-3978	PAR-CLIP	26701625
MIRT456014	hsa-miR-3978	PAR-CLIP	26701625
MIRT456014	hsa-miR-3978	PAR-CLIP	26701625
MIRT456014	hsa-miR-3978	PAR-CLIP	26701625
MIRT456020	hsa-miR-4302	PAR-CLIP	26701625
MIRT456020	hsa-miR-4302	PAR-CLIP	26701625
MIRT456020	hsa-miR-4302	PAR-CLIP	26701625
MIRT456020	hsa-miR-4302	PAR-CLIP	26701625
MIRT456020	hsa-miR-4302	PAR-CLIP	26701625
MIRT456020	hsa-miR-4302	PAR-CLIP	26701625
MIRT456023	hsa-miR-4643	PAR-CLIP	26701625
MIRT456023	hsa-miR-4643	PAR-CLIP	26701625
MIRT456023	hsa-miR-4643	PAR-CLIP	26701625
MIRT456023	hsa-miR-4643	PAR-CLIP	26701625
MIRT456023	hsa-miR-4643	PAR-CLIP	26701625
MIRT456023	hsa-miR-4643	PAR-CLIP	26701625
MIRT456015	hsa-miR-466	PAR-CLIP	26701625
MIRT456015	hsa-miR-466	PAR-CLIP	26701625
MIRT456015	hsa-miR-466	PAR-CLIP	26701625
MIRT456015	hsa-miR-466	PAR-CLIP	26701625
MIRT456015	hsa-miR-466	PAR-CLIP	26701625
MIRT456015	hsa-miR-466	PAR-CLIP	26701625
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	26701625
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	26701625
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	26701625
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	26701625
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	26701625
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	26701625
MIRT456025	hsa-miR-522-3p	PAR-CLIP	26701625
MIRT456025	hsa-miR-522-3p	PAR-CLIP	26701625
MIRT456025	hsa-miR-522-3p	PAR-CLIP	26701625
MIRT456025	hsa-miR-522-3p	PAR-CLIP	26701625
MIRT456025	hsa-miR-522-3p	PAR-CLIP	26701625
MIRT456025	hsa-miR-522-3p	PAR-CLIP	26701625
MIRT456017	hsa-miR-613	PAR-CLIP	26701625
MIRT456017	hsa-miR-613	PAR-CLIP	26701625
MIRT456017	hsa-miR-613	PAR-CLIP	26701625
MIRT456017	hsa-miR-613	PAR-CLIP	26701625
MIRT456017	hsa-miR-613	PAR-CLIP	26701625
MIRT456017	hsa-miR-613	PAR-CLIP	26701625
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	26701625
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	26701625
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	26701625
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	26701625
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	26701625
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	26701625
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT456016	hsa-miR-1257	PAR-CLIP	27292025
MIRT456019	hsa-miR-1-3p	PAR-CLIP	27292025
MIRT456018	hsa-miR-206	PAR-CLIP	27292025
MIRT456026	hsa-miR-224-3p	PAR-CLIP	27292025
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	27292025
MIRT456014	hsa-miR-3978	PAR-CLIP	27292025
MIRT456020	hsa-miR-4302	PAR-CLIP	27292025
MIRT456023	hsa-miR-4643	PAR-CLIP	27292025
MIRT456015	hsa-miR-466	PAR-CLIP	27292025
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	27292025
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	27292025
MIRT456025	hsa-miR-522-3p	PAR-CLIP	27292025
MIRT456017	hsa-miR-613	PAR-CLIP	27292025
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	27292025
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	27292025
MIRT456028	hsa-miR-6768-3p	PAR-CLIP	23592263
MIRT456027	hsa-miR-4694-3p	PAR-CLIP	23592263
MIRT456026	hsa-miR-224-3p	PAR-CLIP	23592263
MIRT456025	hsa-miR-522-3p	PAR-CLIP	23592263
MIRT456024	hsa-miR-4789-3p	PAR-CLIP	23592263
MIRT456023	hsa-miR-4643	PAR-CLIP	23592263
MIRT456022	hsa-miR-3688-3p	PAR-CLIP	23592263
MIRT456021	hsa-miR-6733-3p	PAR-CLIP	23592263
MIRT456020	hsa-miR-4302	PAR-CLIP	23592263
MIRT456019	hsa-miR-1-3p	PAR-CLIP	23592263
MIRT456018	hsa-miR-206	PAR-CLIP	23592263
MIRT456017	hsa-miR-613	PAR-CLIP	23592263
MIRT456016	hsa-miR-1257	PAR-CLIP	23592263
MIRT456015	hsa-miR-466	PAR-CLIP	23592263
MIRT456014	hsa-miR-3978	PAR-CLIP	23592263
MIRT1270057	hsa-miR-1	CLIP-seq
MIRT1270058	hsa-miR-190	CLIP-seq
MIRT1270059	hsa-miR-190b	CLIP-seq
MIRT1270060	hsa-miR-3673	CLIP-seq
MIRT1270061	hsa-miR-522	CLIP-seq
MIRT1270057	hsa-miR-1	CLIP-seq
MIRT1270060	hsa-miR-3673	CLIP-seq
MIRT1270061	hsa-miR-522	CLIP-seq
MIRT1270057	hsa-miR-1	CLIP-seq
MIRT1270058	hsa-miR-190	CLIP-seq
MIRT1270059	hsa-miR-190b	CLIP-seq
MIRT1270060	hsa-miR-3673	CLIP-seq
MIRT1270061	hsa-miR-522	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	NAS	29636472
GO:0000502	Component	Proteasome complex	TAS	8811196
GO:0005515	Function	Protein binding	IPI	12376572, 14733938, 15225636, 16251969, 16990800, 17948026, 19416853, 21900206, 21988832, 25599644, 25959826, 28514442, 29568061, 29636472, 31473102, 32296183, 32814053, 33961781, 34702852, 35271311, 35858375
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	34711951
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	34711951
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	IDA	34711951
GO:0005839	Component	Proteasome core complex	IEA
GO:0005839	Component	Proteasome core complex	ISS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IBA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IDA	30133132
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IEA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	ISS
GO:0042802	Function	Identical protein binding	IPI	15225636, 17948026
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	19489727
GO:0051603	Process	Proteolysis involved in protein catabolic process	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337, 23533145

Other IDs

• MIM: 606607
• HGNC: 9536
• e!Ensembl: ENSG00000101182

Protein

• UniProt ID: O14818
• Protein name: Proteasome subunit alpha type-7 (Proteasome subunit RC6-1) (Proteasome subunit XAPC7) (Proteasome subunit alpha-4) (alpha-4)
• Protein function: Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with
• PDB: 4R3O, 4R67, 5A0Q, 5GJQ, 5GJR, 5L4G, 5LE5, 5LEX, 5LEY, 5LEZ, 5LF0, 5LF1, 5LF3, 5LF4, 5LF6, 5LF7, 5LN3, 5M32, 5T0C, 5T0G, 5T0H, 5T0I, 5T0J, 5VFO, 5VFP, 5VFQ, 5VFR, 5VFS, 5VFT, 5VFU, 6AVO, 6E5B, 6KWY, 6MSB, 6MSD, 6MSE, 6MSG, 6MSH, 6MSJ, 6MSK, 6R70, 6REY, 6RGQ, 6WJD, 6WJN, 6XMJ, 7AWE, 7B12, 7LXV, 7NAN, 7NAO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10584	Proteasome_A_N	3 → 25	Proteasome subunit A N-terminal signature	Family
  PF00227	Proteasome	26 → 211	Proteasome subunit	Domain

• Sequence:

  MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVR
  KICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQ
  SNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEA
  IETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENE
  KKKQKKAS

• Sequence length: 248

Pathways

KEGG:

Proteasome
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Huntington disease
Spinocerebellar ataxia
Prion disease
Pathways of neurodegeneration - multiple diseases

Reactome:

Activation of NF-kappaB in B cells
Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Cross-presentation of soluble exogenous antigens (endosomes)
Autodegradation of Cdh1 by Cdh1:APC/C
SCF-beta-TrCP mediated degradation of Emi1
APC/C:Cdc20 mediated degradation of Securin
APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Cdc20:Phospho-APC/C mediated degradation of Cyclin A
Vpu mediated degradation of CD4
Vif-mediated degradation of APOBEC3G
SCF(Skp2)-mediated degradation of p27/p21
Degradation of beta-catenin by the destruction complex
Downstream TCR signaling
Separation of Sister Chromatids
FCERI mediated NF-kB activation
Autodegradation of the E3 ubiquitin ligase COP1
Regulation of ornithine decarboxylase (ODC)
ABC-family proteins mediated transport
AUF1 (hnRNP D0) binds and destabilizes mRNA
Asymmetric localization of PCP proteins
Degradation of AXIN
Degradation of DVL
Hedgehog ligand biogenesis
Hh mutants that don't undergo autocatalytic processing are degraded by ERAD
Dectin-1 mediated noncanonical NF-kB signaling
CLEC7A (Dectin-1) signaling
Degradation of GLI1 by the proteasome
GLI3 is processed to GLI3R by the proteasome
Hedgehog 'on' state
Regulation of RAS by GAPs
TNFR2 non-canonical NF-kB pathway
NIK-->noncanonical NF-kB signaling
Defective CFTR causes cystic fibrosis
MAPK6/MAPK4 signaling
UCH proteinases
Ub-specific processing proteases
CDT1 association with the CDC6:ORC:origin complex
Orc1 removal from chromatin
CDK-mediated phosphorylation and removal of Cdc6
G2/M Checkpoints
Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
Ubiquitin-dependent degradation of Cyclin D
The role of GTSE1 in G2/M progression after G2 checkpoint
FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
RUNX1 regulates transcription of genes involved in differentiation of HSCs
Regulation of RUNX2 expression and activity
Regulation of RUNX3 expression and activity
Regulation of PTEN stability and activity
Neddylation
Interleukin-1 signaling
Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CATARACT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSMA7-related disorder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Variant of unknown significance	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Arthritis Rheumatoid	Associate	39342401	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	34604955	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	37369480	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Stimulate	23839082	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Inhibit	39342401	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Associate	17586700, 21707890	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Associate	25344067	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	38211649	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	23839082, 37369480	★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	38211649	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	19893039	★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis Acquired	Associate	21707890	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stimulate	27966459	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Stimulate	38211649	★☆☆☆☆ Found in Text Mining only
Wiskott Aldrich Syndrome	Associate	27237736	★☆☆☆☆ Found in Text Mining only