Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5685
Gene name Gene Name - the full gene name approved by the HGNC.	Proteasome 20S subunit alpha 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PSMA4
Synonyms (NCBI Gene) Gene synonyms aliases	HC9, HsT17706, PSC9
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q25.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a core alpha subunit of the 20S proteosome, which is a highly ordered ring-shaped structure composed of four rings of 28 non-identical subunits. Proteasomes cleave peptides in an ATP- and ubiquitin-dependent manner. [provided by RefSeq,

Show/Hide all(133)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049531	hsa-miR-92a-3p	CLASH	23622248
MIRT043029	hsa-miR-324-5p	CLASH	23622248
MIRT1270002	hsa-miR-142-5p	CLIP-seq
MIRT1270003	hsa-miR-208a	CLIP-seq
MIRT1270004	hsa-miR-208b	CLIP-seq
MIRT1270005	hsa-miR-3179	CLIP-seq
MIRT1270006	hsa-miR-338-5p	CLIP-seq
MIRT1270007	hsa-miR-4272	CLIP-seq
MIRT1270008	hsa-miR-4520a-3p	CLIP-seq
MIRT1270009	hsa-miR-4520b-3p	CLIP-seq
MIRT1270010	hsa-miR-4699-5p	CLIP-seq
MIRT1270011	hsa-miR-499-5p	CLIP-seq
MIRT1270012	hsa-miR-548a-5p	CLIP-seq
MIRT1270013	hsa-miR-548ab	CLIP-seq
MIRT1270014	hsa-miR-548ak	CLIP-seq
MIRT1270015	hsa-miR-548b-5p	CLIP-seq
MIRT1270016	hsa-miR-548c-5p	CLIP-seq
MIRT1270017	hsa-miR-548d-5p	CLIP-seq
MIRT1270018	hsa-miR-548h	CLIP-seq
MIRT1270019	hsa-miR-548i	CLIP-seq
MIRT1270020	hsa-miR-548j	CLIP-seq
MIRT1270021	hsa-miR-548k	CLIP-seq
MIRT1270022	hsa-miR-548l	CLIP-seq
MIRT1270023	hsa-miR-548w	CLIP-seq
MIRT1270024	hsa-miR-548y	CLIP-seq
MIRT1270025	hsa-miR-559	CLIP-seq
MIRT1270007	hsa-miR-4272	CLIP-seq
MIRT1270012	hsa-miR-548a-5p	CLIP-seq
MIRT1270013	hsa-miR-548ab	CLIP-seq
MIRT1270014	hsa-miR-548ak	CLIP-seq
MIRT1270015	hsa-miR-548b-5p	CLIP-seq
MIRT1270016	hsa-miR-548c-5p	CLIP-seq
MIRT1270017	hsa-miR-548d-5p	CLIP-seq
MIRT1270018	hsa-miR-548h	CLIP-seq
MIRT1270019	hsa-miR-548i	CLIP-seq
MIRT1270020	hsa-miR-548j	CLIP-seq
MIRT1270021	hsa-miR-548k	CLIP-seq
MIRT1270022	hsa-miR-548l	CLIP-seq
MIRT1270023	hsa-miR-548w	CLIP-seq
MIRT1270024	hsa-miR-548y	CLIP-seq
MIRT1270025	hsa-miR-559	CLIP-seq
MIRT2602776	hsa-miR-1260	CLIP-seq
MIRT2602777	hsa-miR-1260b	CLIP-seq
MIRT2602778	hsa-miR-188-3p	CLIP-seq
MIRT2602779	hsa-miR-203	CLIP-seq
MIRT2602780	hsa-miR-216b	CLIP-seq
MIRT2602781	hsa-miR-3117-3p	CLIP-seq
MIRT2602782	hsa-miR-3130-3p	CLIP-seq
MIRT2602783	hsa-miR-3156-3p	CLIP-seq
MIRT2602784	hsa-miR-3163	CLIP-seq
MIRT2602785	hsa-miR-3169	CLIP-seq
MIRT2602786	hsa-miR-3189-5p	CLIP-seq
MIRT2602787	hsa-miR-3190	CLIP-seq
MIRT2602788	hsa-miR-3614-3p	CLIP-seq
MIRT2602789	hsa-miR-3667-3p	CLIP-seq
MIRT2602790	hsa-miR-380	CLIP-seq
MIRT2602791	hsa-miR-384	CLIP-seq
MIRT2602792	hsa-miR-3911	CLIP-seq
MIRT2602793	hsa-miR-3920	CLIP-seq
MIRT2602794	hsa-miR-3921	CLIP-seq
MIRT2602795	hsa-miR-4297	CLIP-seq
MIRT2602796	hsa-miR-4301	CLIP-seq
MIRT2602797	hsa-miR-4446-5p	CLIP-seq
MIRT2602798	hsa-miR-4495	CLIP-seq
MIRT2602799	hsa-miR-4653-5p	CLIP-seq
MIRT2602800	hsa-miR-4668-3p	CLIP-seq
MIRT2602801	hsa-miR-4758-3p	CLIP-seq
MIRT2602802	hsa-miR-4759	CLIP-seq
MIRT2602803	hsa-miR-522	CLIP-seq
MIRT1270012	hsa-miR-548a-5p	CLIP-seq
MIRT1270013	hsa-miR-548ab	CLIP-seq
MIRT1270014	hsa-miR-548ak	CLIP-seq
MIRT1270015	hsa-miR-548b-5p	CLIP-seq
MIRT1270016	hsa-miR-548c-5p	CLIP-seq
MIRT1270017	hsa-miR-548d-5p	CLIP-seq
MIRT1270018	hsa-miR-548h	CLIP-seq
MIRT1270019	hsa-miR-548i	CLIP-seq
MIRT1270020	hsa-miR-548j	CLIP-seq
MIRT2602804	hsa-miR-548n	CLIP-seq
MIRT1270023	hsa-miR-548w	CLIP-seq
MIRT1270024	hsa-miR-548y	CLIP-seq
MIRT1270025	hsa-miR-559	CLIP-seq
MIRT2602805	hsa-miR-648	CLIP-seq
MIRT2602806	hsa-miR-676	CLIP-seq
MIRT2602807	hsa-miR-7	CLIP-seq
MIRT2602808	hsa-miR-711	CLIP-seq
MIRT2602809	hsa-miR-767-5p	CLIP-seq
MIRT2602776	hsa-miR-1260	CLIP-seq
MIRT2602777	hsa-miR-1260b	CLIP-seq
MIRT2602778	hsa-miR-188-3p	CLIP-seq
MIRT2602779	hsa-miR-203	CLIP-seq
MIRT2602780	hsa-miR-216b	CLIP-seq
MIRT2602781	hsa-miR-3117-3p	CLIP-seq
MIRT2602782	hsa-miR-3130-3p	CLIP-seq
MIRT2602783	hsa-miR-3156-3p	CLIP-seq
MIRT2602784	hsa-miR-3163	CLIP-seq
MIRT2602785	hsa-miR-3169	CLIP-seq
MIRT2602786	hsa-miR-3189-5p	CLIP-seq
MIRT2602787	hsa-miR-3190	CLIP-seq
MIRT2602788	hsa-miR-3614-3p	CLIP-seq
MIRT2602789	hsa-miR-3667-3p	CLIP-seq
MIRT2602790	hsa-miR-380	CLIP-seq
MIRT2602791	hsa-miR-384	CLIP-seq
MIRT2602792	hsa-miR-3911	CLIP-seq
MIRT2602793	hsa-miR-3920	CLIP-seq
MIRT2602794	hsa-miR-3921	CLIP-seq
MIRT2602795	hsa-miR-4297	CLIP-seq
MIRT2602796	hsa-miR-4301	CLIP-seq
MIRT2602797	hsa-miR-4446-5p	CLIP-seq
MIRT2602798	hsa-miR-4495	CLIP-seq
MIRT2602799	hsa-miR-4653-5p	CLIP-seq
MIRT2602800	hsa-miR-4668-3p	CLIP-seq
MIRT2602801	hsa-miR-4758-3p	CLIP-seq
MIRT2602802	hsa-miR-4759	CLIP-seq
MIRT2602803	hsa-miR-522	CLIP-seq
MIRT1270012	hsa-miR-548a-5p	CLIP-seq
MIRT1270013	hsa-miR-548ab	CLIP-seq
MIRT1270014	hsa-miR-548ak	CLIP-seq
MIRT1270015	hsa-miR-548b-5p	CLIP-seq
MIRT1270016	hsa-miR-548c-5p	CLIP-seq
MIRT1270017	hsa-miR-548d-5p	CLIP-seq
MIRT1270018	hsa-miR-548h	CLIP-seq
MIRT1270019	hsa-miR-548i	CLIP-seq
MIRT1270020	hsa-miR-548j	CLIP-seq
MIRT2602804	hsa-miR-548n	CLIP-seq
MIRT1270023	hsa-miR-548w	CLIP-seq
MIRT1270024	hsa-miR-548y	CLIP-seq
MIRT1270025	hsa-miR-559	CLIP-seq
MIRT2602805	hsa-miR-648	CLIP-seq
MIRT2602806	hsa-miR-676	CLIP-seq
MIRT2602807	hsa-miR-7	CLIP-seq
MIRT2602808	hsa-miR-711	CLIP-seq
MIRT2602809	hsa-miR-767-5p	CLIP-seq

Show/Hide all(46)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000932	Component	P-body	ISS
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0004175	Function	Endopeptidase activity	IBA	21873635
GO:0004298	Function	Threonine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	12376572, 14733938, 15225636, 15887188, 17948026, 19581590, 22801492, 25416956, 25599644, 25959826, 29568061, 29636472, 32296183, 32814053
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	IBA	21873635
GO:0005839	Component	Proteasome core complex	ISS
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0010499	Process	Proteasomal ubiquitin-independent protein catabolic process	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016032	Process	Viral process	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IBA	21873635
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IDA	30133132
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	ISS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS

MIM	HGNC	e!Ensembl
176846	9533	ENSG00000041357

Protein

UniProt ID

P25789

Protein name

Proteasome subunit alpha type-4 (Macropain subunit C9) (Multicatalytic endopeptidase complex subunit C9) (Proteasome component C9) (Proteasome subunit L) (Proteasome subunit alpha-3) (alpha-3)

Protein function

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with

PDB

4R3O , 4R67 , 5A0Q , 5GJQ , 5GJR , 5L4G , 5LE5 , 5LEX , 5LEY , 5LEZ , 5LF0 , 5LF1 , 5LF3 , 5LF4 , 5LF6 , 5LF7 , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFO , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 6AVO , 6E5B , 6KWY , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6R70 , 6REY , 6RGQ , 6WJD , 6WJN , 6XMJ , 7AWE , 7B12 , 7LXV , 7NAN , 7NAO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10584	Proteasome_A_N	5 → 27	Proteasome subunit A N-terminal signature	Family
PF00227	Proteasome	28 → 216	Proteasome subunit	Domain

Sequence

MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVF
FSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQA
YTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYK
EGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKH
EEEEAKAEREKKEKEQKEKDK

Sequence length

261

Interactions

View interactions

	KEGG		Reactome
	Proteasome Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Spinocerebellar ataxia Prion disease Pathways of neurodegeneration - multiple diseases		Activation of NF-kappaB in B cells Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha Cross-presentation of soluble exogenous antigens (endosomes) Autodegradation of Cdh1 by Cdh1:APC/C SCF-beta-TrCP mediated degradation of Emi1 APC/C:Cdc20 mediated degradation of Securin APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 Cdc20:Phospho-APC/C mediated degradation of Cyclin A Vpu mediated degradation of CD4 Vif-mediated degradation of APOBEC3G SCF(Skp2)-mediated degradation of p27/p21 Degradation of beta-catenin by the destruction complex Downstream TCR signaling Separation of Sister Chromatids FCERI mediated NF-kB activation Autodegradation of the E3 ubiquitin ligase COP1 Regulation of ornithine decarboxylase (ODC) ABC-family proteins mediated transport AUF1 (hnRNP D0) binds and destabilizes mRNA Asymmetric localization of PCP proteins Degradation of AXIN Degradation of DVL Hedgehog ligand biogenesis Hh mutants that don't undergo autocatalytic processing are degraded by ERAD Dectin-1 mediated noncanonical NF-kB signaling CLEC7A (Dectin-1) signaling Degradation of GLI1 by the proteasome GLI3 is processed to GLI3R by the proteasome Hedgehog 'on' state Regulation of RAS by GAPs TNFR2 non-canonical NF-kB pathway NIK-->noncanonical NF-kB signaling Defective CFTR causes cystic fibrosis MAPK6/MAPK4 signaling UCH proteinases Ub-specific processing proteases CDT1 association with the CDC6:ORC:origin complex Orc1 removal from chromatin CDK-mediated phosphorylation and removal of Cdc6 G2/M Checkpoints Ubiquitin Mediated Degradation of Phosphorylated Cdc25A Ubiquitin-dependent degradation of Cyclin D The role of GTSE1 in G2/M progression after G2 checkpoint FBXL7 down-regulates AURKA during mitotic entry and in early mitosis RUNX1 regulates transcription of genes involved in differentiation of HSCs Regulation of RUNX2 expression and activity Regulation of RUNX3 expression and activity Regulation of PTEN stability and activity Neddylation Interleukin-1 signaling Antigen processing: Ubiquitination & Proteasome degradation

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Carcinoma	Carcinoma, Carcinoma, Spindle-Cell, Undifferentiated carcinoma	rs121912654, rs555607708, rs786202962, rs1564055259	16316942
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	22491018

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Evidence	References	Source
Unknown
Myocardial infarction	Myocardial Infarction		21211798	ClinVar
Lung adenocarcinoma	Lung adenocarcinoma	Validation that loss of Tgfbr2 results in more aggressive and T cell-excluded KP lung tumors		GWAS, CBGDA
Dental caries	Dental caries			GWAS

Show/Hide Text Mining Associations (18)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	29486777
Aneurysm Ruptured	Stimulate	39181687
Aortic Aneurysm	Associate	35952493
Aortic Aneurysm Abdominal	Associate	35952493
Carcinoma Squamous Cell	Associate	29486777
Colorectal Neoplasms	Associate	25206290
Diabetes Mellitus Type 1	Associate	23637351
Graves Ophthalmopathy	Associate	36076300
Intracranial Aneurysm	Associate	35952493, 39181687
Lung Neoplasms	Associate	18385676, 18780872, 19789337, 20587604
Macular Degeneration	Associate	34629418
Neoplasms	Associate	19789337, 28181565
Parkinson Disease	Associate	37219663
Pulmonary Disease Chronic Obstructive	Associate	29422661
Small Cell Lung Carcinoma	Associate	29486777
Smoke Inhalation Injury	Associate	21436384
Stomach Neoplasms	Stimulate	27966459
Subarachnoid Hemorrhage	Associate	39181687

PSMA4 (proteasome 20S subunit alpha 4)