PSMA2 (proteasome 20S subunit alpha 2)

Gene

• Entrez ID: 5683
• Gene name: Proteasome 20S subunit alpha 2
• Gene symbol: PSMA2
• Synonyms (NCBI Gene): HC3, MU, PMSA2, PSC2
• Chromosome: 7
• Chromosome location: 7p14.1
• Summary: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021801	hsa-miR-132-3p	Microarray	17612493
MIRT052368	hsa-let-7a-5p	CLASH	23622248
MIRT048696	hsa-miR-99a-5p	CLASH	23622248
MIRT048439	hsa-miR-100-5p	CLASH	23622248
MIRT045788	hsa-miR-191-5p	CLASH	23622248
MIRT045072	hsa-miR-186-5p	CLASH	23622248
MIRT045072	hsa-miR-186-5p	CLASH	23622248
MIRT044238	hsa-miR-29c-3p	CLASH	23622248
MIRT521605	hsa-miR-212-3p	PAR-CLIP	20371350
MIRT021801	hsa-miR-132-3p	PAR-CLIP	20371350
MIRT521605	hsa-miR-212-3p	PAR-CLIP	20371350
MIRT021801	hsa-miR-132-3p	PAR-CLIP	20371350
MIRT521604	hsa-miR-548ac	PAR-CLIP	20371350
MIRT521603	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT521602	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT521601	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT521600	hsa-miR-548z	PAR-CLIP	20371350
MIRT521599	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT521598	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT521597	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT521596	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT521595	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT521594	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT521593	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT521592	hsa-miR-595	PAR-CLIP	20371350
MIRT521591	hsa-miR-3159	PAR-CLIP	20371350
MIRT521590	hsa-miR-1250-3p	PAR-CLIP	20371350
MIRT521589	hsa-miR-153-5p	PAR-CLIP	20371350
MIRT521588	hsa-miR-616-3p	PAR-CLIP	20371350
MIRT521587	hsa-miR-302c-5p	PAR-CLIP	20371350
MIRT521586	hsa-miR-651-5p	PAR-CLIP	20371350
MIRT510919	hsa-miR-497-3p	PAR-CLIP	20371350
MIRT510918	hsa-miR-5680	PAR-CLIP	20371350
MIRT510916	hsa-miR-3668	PAR-CLIP	20371350
MIRT510917	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT510915	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT510914	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT510913	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT510912	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT510911	hsa-miR-548aw	PAR-CLIP	20371350
MIRT521605	hsa-miR-212-3p	PAR-CLIP	23446348
MIRT021801	hsa-miR-132-3p	PAR-CLIP	23446348
MIRT521605	hsa-miR-212-3p	PAR-CLIP	23446348
MIRT021801	hsa-miR-132-3p	PAR-CLIP	23446348
MIRT521604	hsa-miR-548ac	PAR-CLIP	23446348
MIRT521603	hsa-miR-548bb-3p	PAR-CLIP	23446348
MIRT521602	hsa-miR-548d-3p	PAR-CLIP	23446348
MIRT521601	hsa-miR-548h-3p	PAR-CLIP	23446348
MIRT521600	hsa-miR-548z	PAR-CLIP	23446348
MIRT521599	hsa-miR-548ae-3p	PAR-CLIP	23446348
MIRT521598	hsa-miR-548ah-3p	PAR-CLIP	23446348
MIRT521597	hsa-miR-548aj-3p	PAR-CLIP	23446348
MIRT521596	hsa-miR-548am-3p	PAR-CLIP	23446348
MIRT521595	hsa-miR-548aq-3p	PAR-CLIP	23446348
MIRT521594	hsa-miR-548j-3p	PAR-CLIP	23446348
MIRT521593	hsa-miR-548x-3p	PAR-CLIP	23446348
MIRT521592	hsa-miR-595	PAR-CLIP	23446348
MIRT521591	hsa-miR-3159	PAR-CLIP	23446348
MIRT521590	hsa-miR-1250-3p	PAR-CLIP	23446348
MIRT521589	hsa-miR-153-5p	PAR-CLIP	23446348
MIRT521588	hsa-miR-616-3p	PAR-CLIP	23446348
MIRT521587	hsa-miR-302c-5p	PAR-CLIP	23446348
MIRT521586	hsa-miR-651-5p	PAR-CLIP	23446348
MIRT510919	hsa-miR-497-3p	PAR-CLIP	23446348
MIRT510918	hsa-miR-5680	PAR-CLIP	23446348
MIRT510916	hsa-miR-3668	PAR-CLIP	23446348
MIRT510917	hsa-miR-548aj-5p	PAR-CLIP	23446348
MIRT510915	hsa-miR-548f-5p	PAR-CLIP	23446348
MIRT510914	hsa-miR-548g-5p	PAR-CLIP	23446348
MIRT510913	hsa-miR-548x-5p	PAR-CLIP	23446348
MIRT510912	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT510911	hsa-miR-548aw	PAR-CLIP	23446348
MIRT521605	hsa-miR-212-3p	PAR-CLIP	20371350
MIRT021801	hsa-miR-132-3p	PAR-CLIP	20371350
MIRT521605	hsa-miR-212-3p	PAR-CLIP	20371350
MIRT021801	hsa-miR-132-3p	PAR-CLIP	20371350
MIRT521604	hsa-miR-548ac	PAR-CLIP	20371350
MIRT521603	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT521602	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT521601	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT521600	hsa-miR-548z	PAR-CLIP	20371350
MIRT521599	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT521598	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT521597	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT521596	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT521595	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT521594	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT521593	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT521592	hsa-miR-595	PAR-CLIP	20371350
MIRT521591	hsa-miR-3159	PAR-CLIP	20371350
MIRT521590	hsa-miR-1250-3p	PAR-CLIP	20371350
MIRT521589	hsa-miR-153-5p	PAR-CLIP	20371350
MIRT521588	hsa-miR-616-3p	PAR-CLIP	20371350
MIRT521587	hsa-miR-302c-5p	PAR-CLIP	20371350
MIRT521586	hsa-miR-651-5p	PAR-CLIP	20371350
MIRT510919	hsa-miR-497-3p	PAR-CLIP	20371350
MIRT510918	hsa-miR-5680	PAR-CLIP	20371350
MIRT510916	hsa-miR-3668	PAR-CLIP	20371350
MIRT510917	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT510915	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT510914	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT510913	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT510912	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT510911	hsa-miR-548aw	PAR-CLIP	20371350
MIRT521605	hsa-miR-212-3p	PAR-CLIP	23446348
MIRT021801	hsa-miR-132-3p	PAR-CLIP	23446348
MIRT521605	hsa-miR-212-3p	PAR-CLIP	23446348
MIRT021801	hsa-miR-132-3p	PAR-CLIP	23446348
MIRT521604	hsa-miR-548ac	PAR-CLIP	23446348
MIRT521603	hsa-miR-548bb-3p	PAR-CLIP	23446348
MIRT521602	hsa-miR-548d-3p	PAR-CLIP	23446348
MIRT521601	hsa-miR-548h-3p	PAR-CLIP	23446348
MIRT521600	hsa-miR-548z	PAR-CLIP	23446348
MIRT521599	hsa-miR-548ae-3p	PAR-CLIP	23446348
MIRT521598	hsa-miR-548ah-3p	PAR-CLIP	23446348
MIRT521597	hsa-miR-548aj-3p	PAR-CLIP	23446348
MIRT521596	hsa-miR-548am-3p	PAR-CLIP	23446348
MIRT521595	hsa-miR-548aq-3p	PAR-CLIP	23446348
MIRT521594	hsa-miR-548j-3p	PAR-CLIP	23446348
MIRT521593	hsa-miR-548x-3p	PAR-CLIP	23446348
MIRT521592	hsa-miR-595	PAR-CLIP	23446348
MIRT521591	hsa-miR-3159	PAR-CLIP	23446348
MIRT521590	hsa-miR-1250-3p	PAR-CLIP	23446348
MIRT521589	hsa-miR-153-5p	PAR-CLIP	23446348
MIRT521588	hsa-miR-616-3p	PAR-CLIP	23446348
MIRT521587	hsa-miR-302c-5p	PAR-CLIP	23446348
MIRT521586	hsa-miR-651-5p	PAR-CLIP	23446348
MIRT510919	hsa-miR-497-3p	PAR-CLIP	23446348
MIRT510918	hsa-miR-5680	PAR-CLIP	23446348
MIRT510916	hsa-miR-3668	PAR-CLIP	23446348
MIRT510917	hsa-miR-548aj-5p	PAR-CLIP	23446348
MIRT510915	hsa-miR-548f-5p	PAR-CLIP	23446348
MIRT510914	hsa-miR-548g-5p	PAR-CLIP	23446348
MIRT510913	hsa-miR-548x-5p	PAR-CLIP	23446348
MIRT510912	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT510911	hsa-miR-548aw	PAR-CLIP	23446348
MIRT1269965	hsa-miR-132	CLIP-seq
MIRT1269966	hsa-miR-212	CLIP-seq
MIRT1269967	hsa-miR-2276	CLIP-seq
MIRT1269968	hsa-miR-2278	CLIP-seq
MIRT1269969	hsa-miR-3167	CLIP-seq
MIRT1269970	hsa-miR-3663-3p	CLIP-seq
MIRT1269971	hsa-miR-376a	CLIP-seq
MIRT1269972	hsa-miR-376b	CLIP-seq
MIRT1269973	hsa-miR-4420	CLIP-seq
MIRT1269974	hsa-miR-4772-3p	CLIP-seq
MIRT1269975	hsa-miR-548ae	CLIP-seq
MIRT1269976	hsa-miR-548aj	CLIP-seq
MIRT1269977	hsa-miR-548am	CLIP-seq
MIRT1269978	hsa-miR-548x	CLIP-seq
MIRT1269979	hsa-miR-616	CLIP-seq
MIRT1269980	hsa-miR-629	CLIP-seq
MIRT1269981	hsa-miR-651	CLIP-seq
MIRT1269982	hsa-miR-876-5p	CLIP-seq
MIRT1269965	hsa-miR-132	CLIP-seq
MIRT2305655	hsa-miR-182	CLIP-seq
MIRT1269966	hsa-miR-212	CLIP-seq
MIRT2305656	hsa-miR-498	CLIP-seq
MIRT1269979	hsa-miR-616	CLIP-seq
MIRT2305655	hsa-miR-182	CLIP-seq
MIRT2602763	hsa-miR-3689a-5p	CLIP-seq
MIRT2602764	hsa-miR-3689b	CLIP-seq
MIRT2602765	hsa-miR-3689e	CLIP-seq
MIRT2602766	hsa-miR-3689f	CLIP-seq
MIRT2602767	hsa-miR-4282	CLIP-seq
MIRT2602768	hsa-miR-4679	CLIP-seq
MIRT2602769	hsa-miR-4766-3p	CLIP-seq
MIRT2602770	hsa-miR-548k	CLIP-seq
MIRT2602771	hsa-miR-548n	CLIP-seq
MIRT2602772	hsa-miR-548t	CLIP-seq
MIRT2602773	hsa-miR-549	CLIP-seq
MIRT2602774	hsa-miR-578	CLIP-seq
MIRT2602775	hsa-miR-590-3p	CLIP-seq
MIRT2305655	hsa-miR-182	CLIP-seq
MIRT2602763	hsa-miR-3689a-5p	CLIP-seq
MIRT2602764	hsa-miR-3689b	CLIP-seq
MIRT2602765	hsa-miR-3689e	CLIP-seq
MIRT2602766	hsa-miR-3689f	CLIP-seq
MIRT2602768	hsa-miR-4679	CLIP-seq
MIRT2602770	hsa-miR-548k	CLIP-seq
MIRT2602771	hsa-miR-548n	CLIP-seq
MIRT2602772	hsa-miR-548t	CLIP-seq
MIRT2602773	hsa-miR-549	CLIP-seq
MIRT2602774	hsa-miR-578	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000932	Component	P-body	ISS
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0004175	Function	Endopeptidase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	12376572, 14733938, 15225636, 15887188, 17189198, 17948026, 21900206, 21988832, 22046132, 25599644, 29568061, 29636472, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	IBA	21873635
GO:0005839	Component	Proteasome core complex	ISS
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0009615	Process	Response to virus	IEP	16548883
GO:0010499	Process	Proteasomal ubiquitin-independent protein catabolic process	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016579	Process	Protein deubiquitination	TAS
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IBA	21873635
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	ISS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	ISS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

Other IDs

• MIM: 176842
• HGNC: 9531
• e!Ensembl: ENSG00000106588

Protein

• UniProt ID: P25787
• Protein name: Proteasome subunit alpha type-2 (Macropain subunit C3) (Multicatalytic endopeptidase complex subunit C3) (Proteasome component C3) (Proteasome subunit alpha-2) (alpha-2)
• Protein function: Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with
• PDB: 4R3O, 4R67, 5A0Q, 5GJQ, 5GJR, 5L4G, 5LE5, 5LEX, 5LEY, 5LEZ, 5LF0, 5LF1, 5LF3, 5LF4, 5LF6, 5LF7, 5LN3, 5M32, 5T0C, 5T0G, 5T0H, 5T0I, 5T0J, 5VFO, 5VFP, 5VFQ, 5VFR, 5VFS, 5VFT, 5VFU, 6AVO, 6E5B, 6KWY, 6MSB, 6MSD, 6MSE, 6MSG, 6MSH, 6MSJ, 6MSK, 6R70, 6REY, 6RGQ, 6WJD, 6WJN, 6XMJ, 7AWE, 7B12, 7LXV, 7NAN, 7NAO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10584	Proteasome_A_N	6 → 28	Proteasome subunit A N-terminal signature	Family
  PF00227	Proteasome	29 → 213	Proteasome subunit	Domain

• Sequence:

  MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDER
  SVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQE
  YTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNE
  DLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA

• Sequence length: 234

Pathways

KEGG:

Proteasome
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Huntington disease
Spinocerebellar ataxia
Prion disease
Pathways of neurodegeneration - multiple diseases

Reactome:

Activation of NF-kappaB in B cells
Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Cross-presentation of soluble exogenous antigens (endosomes)
Autodegradation of Cdh1 by Cdh1:APC/C
SCF-beta-TrCP mediated degradation of Emi1
APC/C:Cdc20 mediated degradation of Securin
APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Cdc20:Phospho-APC/C mediated degradation of Cyclin A
Vpu mediated degradation of CD4
Vif-mediated degradation of APOBEC3G
SCF(Skp2)-mediated degradation of p27/p21
Degradation of beta-catenin by the destruction complex
Downstream TCR signaling
Separation of Sister Chromatids
FCERI mediated NF-kB activation
Autodegradation of the E3 ubiquitin ligase COP1
Regulation of ornithine decarboxylase (ODC)
ABC-family proteins mediated transport
AUF1 (hnRNP D0) binds and destabilizes mRNA
Asymmetric localization of PCP proteins
Degradation of AXIN
Degradation of DVL
Hedgehog ligand biogenesis
Hh mutants that don't undergo autocatalytic processing are degraded by ERAD
Dectin-1 mediated noncanonical NF-kB signaling
CLEC7A (Dectin-1) signaling
Degradation of GLI1 by the proteasome
GLI3 is processed to GLI3R by the proteasome
Hedgehog 'on' state
Regulation of RAS by GAPs
TNFR2 non-canonical NF-kB pathway
NIK-->noncanonical NF-kB signaling
Defective CFTR causes cystic fibrosis
MAPK6/MAPK4 signaling
UCH proteinases
Ub-specific processing proteases
Neutrophil degranulation
CDT1 association with the CDC6:ORC:origin complex
Orc1 removal from chromatin
CDK-mediated phosphorylation and removal of Cdc6
G2/M Checkpoints
Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
Ubiquitin-dependent degradation of Cyclin D
The role of GTSE1 in G2/M progression after G2 checkpoint
FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
RUNX1 regulates transcription of genes involved in differentiation of HSCs
Regulation of RUNX2 expression and activity
Regulation of RUNX3 expression and activity
Regulation of PTEN stability and activity
Neddylation
Interleukin-1 signaling
Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Colorectal cancer	Colorectal Carcinoma	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800, rs63750198, rs63751109, rs863223312, rs63750710, rs63751615, rs63750206, rs63750781, rs63750899, rs63750691, rs63750217, rs121912965, rs63749939, rs63751194, rs63750693, rs63750540, rs63751221, rs193922370, rs80359596, rs397514632, rs483352909, rs200495564, rs397514684, rs397516436, rs398122386, rs79512956, rs74953290, rs587779001, rs63750677, rs63749837, rs267607816, rs63751715, rs267607819, rs267607815, rs267607822, rs63749906, rs587778883, rs63750472, rs63751012, rs63750715, rs63750580, rs267607706, rs267607709, rs267607710, rs587778894, rs63750749, rs63750483, rs63751015, rs63751153, rs63751094, rs63751118, rs63750316, rs63749981, rs587778906, rs267607821, rs587778908, rs63750020, rs587778909, rs63750713, rs267607825, rs63751592, rs281864936, rs587778913, rs587778914, rs63749795, rs63750855, rs63749916, rs63749923, rs63751472, rs63751689, rs267607832, rs267607837, rs267607836, rs587778923, rs63750028, rs587778928, rs587778929, rs587778930, rs63751277, rs587778933, rs267607842, rs267607843, rs63750192, rs587778934, rs63750193, rs587778937, rs587778938, rs267607845, rs63751244, rs63751393, rs63751460, rs267607849, rs267607853, rs267607856, rs267607850, rs63751657, rs267607854, rs267607852, rs587778942, rs63750309, rs63750587, rs63749863, rs63751486, rs63750016, rs63749868, rs63750375, rs63750035, rs63750604, rs63750386, rs63750150, rs63750486, rs63751428, rs267607866, rs63749986, rs63751594, rs63750152, rs63750850, rs267607867, rs267607868, rs63751632, rs267607871, rs63751892, rs587778956, rs63750469, rs587778958, rs63749792, rs267607875, rs63751255, rs281864938, rs63751202, rs63750726, rs63751310, rs63749900, rs587778964, rs267607879, rs267607878, rs587778966, rs267607883, rs267607887, rs63750061, rs63750663, rs587778968, rs587778971, rs63750809, rs63749867, rs63750864, rs587778972, rs63751275, rs267607718, rs267607722, rs63750769, rs267607717, rs587778973, rs267607716, rs267607720, rs63749995, rs63750859, rs587778975, rs63750114, rs587778976, rs63750603, rs267607889, rs267607723, rs63750561, rs63750499, rs63751642, rs63751022, rs587778981, rs63750971, rs267607898, rs267607906, rs267607903, rs587778989, rs587778992, rs267607894, rs267607901, rs267607892, rs63750437, rs587778997, rs587778998, rs63750005, rs63750641, rs63751421, rs11541859, rs63750266, rs111052004, rs267607726, rs267607727, rs63750453, rs267607734, rs267607735, rs63751665, rs267607736, rs267607732, rs63749816, rs63750539, rs267607739, rs587779006, rs587779008, rs267607745, rs267607742, rs63751595, rs267607743, rs587779010, rs587779012, rs63750057, rs63749818, rs63751124, rs587779014, rs587779015, rs63749820, rs63751302, rs267607750, rs267607751, rs267607749, rs63750891, rs63749959, rs63749804, rs267607765, rs267607760, rs587779021, rs267607759, rs63750515, rs587779023, rs63751021, rs63751480, rs267607772, rs267607773, rs587779024, rs63751653, rs587779027, rs267607767, rs587779029, rs63750706, rs63750385, rs267607774, rs267607778, rs267607780, rs587779034, rs63751711, rs267607784, rs587779035, rs63750823, rs63750822, rs267607787, rs63750303, rs63749839, rs63749827, rs267607789, rs267607790, rs267607791, rs267607786, rs267607771, rs267607795, rs267607794, rs267607788, rs267607799, rs267607801, rs587779045, rs63750034, rs587779047, rs63750216, rs63751707, rs63751598, rs267607803, rs267607777, rs63750144, rs267607805, rs63750547, rs63750489, rs63750993, rs587779054, rs63751259, rs63749926, rs63750796, rs587779058, rs63750745, rs63750582, rs180177084, rs587779866, rs200389141, rs587779950, rs587780104, rs587780183, rs587778536, rs587780683, rs587781554, rs267607712, rs587777627, rs587783057, rs730881734, rs41542214, rs730881273, rs786203456, rs786201990, rs786202767, rs748005072, rs786204317, rs786204318, rs797045117, rs63750549, rs863225383, rs863225384, rs863225373, rs863225376, rs863225377, rs863225378, rs863225379, rs863225380, rs863225381, rs63750059, rs267607823, rs864622457, rs869312767, rs869312753, rs876661059, rs876658915, rs876658923, rs876660860, rs876660822, rs876660458, rs876660214, rs876658657, rs876658247, rs876659226, rs876658821, rs876660589, rs876659068, rs876659681, rs876659608, rs878853794, rs878853778, rs878853780, rs878853785, rs886039423, rs886039424, rs1057517543, rs1057517541, rs756843954, rs1057517617, rs1057517558, rs1057519256, rs1060500689, rs764085979, rs1060500707, rs1060500699, rs1060500706, rs1060500703, rs1064795341, rs1064793607, rs1064794348, rs1064795441, rs1064794373, rs1064793172, rs1064794122, rs1064795515, rs1064794331, rs63750978, rs1114167435, rs1553641362, rs63751448, rs1553648029, rs1553648058, rs587778903, rs1553653237, rs1553664353, rs267607744, rs1553647995, rs1553648047, rs1553653084, rs1553663750, rs1553664436, rs1553488015, rs1553637293, rs63750310, rs63750443, rs63751596, rs1553646681, rs550890395, rs1064796057, rs1553642079, rs1553648023, rs587782087, rs746536721, rs1553653037, rs1248251121, rs1553646602, rs1434898623, rs1553665683, rs1553648068, rs1553645331, rs1553644123, rs1553658246, rs1553651299, rs1553648149, rs1553663159, rs1302248679, rs1553664119, rs1553658009, rs1553665977, rs1416171624, rs1553663834, rs1553664617, rs1553664702, rs1553647969, rs1553648040, rs1437454428, rs1553641273, rs63751101, rs1553646764, rs1553648225, rs1554082118, rs1553648201, rs1553638868, rs1553665866, rs376736188, rs1553642707, rs1553645226, rs1553652883, rs63751435, rs1553653115, rs1553653195, rs63750300, rs1553662622, rs1553658104, rs1553648220, rs1559544064, rs63750584, rs267608083, rs1559551570, rs1559575107, rs1559553501, rs1565986506, rs1559524405, rs1559553492, rs1559554339, rs1559588540, rs1559558071, rs761329565, rs1559521039, rs1559574795, rs1567221417, rs1559578422, rs1481129490, rs1570714352, rs779783209, rs1575376830, rs1575469070, rs1575537843, rs1575620443, rs1575621506, rs587779022, rs1575414904, rs1575449093, rs1575469505, rs1575536254, rs1575537933, rs1575632112, rs1575639851, rs1575441094, rs1575449402, rs267607831, rs2081922847, rs2083403132, rs2085415927, rs2085469647, rs2043913790, rs147542208
Osteoporosis	Osteoporosis, Age-Related, Osteoporosis, Osteoporosis, Senile, Post-Traumatic Osteoporosis	rs72658152, rs72667023, rs587776916, rs72656370, rs768615287	18924182

Associations from Text Mining
Disease Name	Relationship Type	References
Amyloidosis	Associate	15388584
Arthritis Rheumatoid	Associate	39342401
Atherosclerosis	Associate	11533053
Diabetes Mellitus Type 2	Stimulate	33684886
Diabetes Mellitus Type 2	Inhibit	39342401
Immunoglobulin Light chain Amyloidosis	Associate	15388584
Influenza Human	Associate	35019712
Leukemia Myeloid Acute	Associate	29781401
Multiple Myeloma	Associate	15388584
Neoplasms	Stimulate	33684886
Stomach Neoplasms	Stimulate	27966459
Uterine Cervical Neoplasms	Associate	33684886