PSG9 (pregnancy specific beta-1-glycoprotein 9)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 5678
Gene name Pregnancy specific beta-1-glycoprotein 9
Gene symbol PSG9
Synonyms (NCBI Gene)
PS34PSBG-11PSBG-9PSG11PSGII
Chromosome 19
Chromosome location 19q13.31
Summary The protein encoded by this gene is a member of the pregnancy-specific glycoprotein (PSG) family. This protein family and the closely related carcinoembryonic antigen cell adhesion molecule (CEACAM) gene family are both members of the immunoglobulin super
miRNA miRNA information provided by mirtarbase database.
3
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (3)
miRTarBase ID miRNA Experiments Reference
MIRT019350 hsa-miR-148b-3p Microarray 17612493
MIRT022466 hsa-miR-124-3p Microarray 18668037
MIRT023717 hsa-miR-1-3p Microarray 18668037
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (10)
GO ID Ontology Definition Evidence Reference
GO:0002461 Process Tolerance induction dependent upon immune response IDA 27389696
GO:0002774 Process Fc receptor mediated inhibitory signaling pathway IDA 27389696
GO:0005576 Component Extracellular region IEA
GO:0007179 Process Transforming growth factor beta receptor signaling pathway IDA 27389696
GO:0007565 Process Female pregnancy TAS 1690992, 1922019
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
176398 9526 ENSG00000183668
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q00887
Protein name Pregnancy-specific beta-1-glycoprotein 9 (PS-beta-G-9) (PSBG-9) (Pregnancy-specific glycoprotein 9) (PS34) (Pregnancy-specific beta-1 glycoprotein B) (PS-beta-B) (Pregnancy-specific beta-1-glycoprotein 11) (PS-beta-G-11) (PSBG-11) (Pregnancy-specific glyc
Protein function Binds to the small latent transforming growth factor-beta complex, consisting of the N-terminal TGFB1 latency-associated peptide (LAP) and the mature form of TGFB1, thereby leading to the activation of TGFB1 (PubMed:27389696). The activation of
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 38 → 141 Immunoglobulin V-set domain Domain
PF13895 Ig_2 334 → 413 Immunoglobulin domain Domain
Sequence 
MGPLPAPSCTQRITWKGLLLTASLLNFWNPPTTAEVTIEAQPPKVSEGKDVLLLVHNLPQ
NLPGYFWYKGEMTDLYHYIISYIVDGKIIIYGPAYSGRETVYSNASLLIQNVTRKDAGTY
TLHIIKRGDETREEIRHFTFTLYLETPKPYISSSNLNPREAMEAVRLICDPETLDASYLW
WMNGQSLPVTHRLQLSKTNRTLYLFGVTKYIAGPYECEIRNPVSASRSDPVTLNLLPKLP
IPYITINNLNPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSPGVKRPIENRILILPSV
TRNETGPYQCEIRDRYGGLRSNPVILNVLYGPDLPRIYPSFTYYRSGENLDLSCFTESNP
PAEYFWTINGKFQQSGQKLFIPQITRNHSGLYACSVHNSATGKEISKSMTVKVSGPCHGD
LTESQS
Sequence length 426
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Cell surface interactions at the vascular wall
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (2)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
AUTISM SPECTRUM DISORDER — CTD
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1 Uncertain significance ClinVar
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (6)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Adenoma Associate 15982419
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenomatous Polyposis Coli Stimulate 15982419
★★★★★
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Associate 15982419
★★★★★
★☆☆☆☆
Found in Text Mining only
Neoplasms Associate 15982419
★★★★★
★☆☆☆☆
Found in Text Mining only
Pre Eclampsia Stimulate 35322669
★★★★★
★☆☆☆☆
Found in Text Mining only
Preeclamptic toxemia Stimulate 35322669
★★★★★
★☆☆☆☆
Found in Text Mining only