PSG2 (pregnancy specific beta-1-glycoprotein 2)

Gene

• Entrez ID: 5670
• Gene name: Pregnancy specific beta-1-glycoprotein 2
• Gene symbol: PSG2
• Synonyms (NCBI Gene): CEA, PSBG2, PSG1
• Chromosome: 19
• Chromosome location: 19q13.31
• Summary: The human pregnancy-specific glycoproteins (PSGs) are a family of proteins that are synthesized in large amounts by placental trophoblasts and released into the maternal circulation during pregnancy. Molecular cloning and analysis of several PSG genes has

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019257	hsa-miR-148b-3p	Microarray	17612493
MIRT1269684	hsa-miR-1178	CLIP-seq
MIRT1269685	hsa-miR-1206	CLIP-seq
MIRT1269686	hsa-miR-3913-3p	CLIP-seq
MIRT1269687	hsa-miR-489	CLIP-seq
MIRT1269688	hsa-miR-494	CLIP-seq
MIRT1269689	hsa-miR-499-3p	CLIP-seq
MIRT1269690	hsa-miR-499a-3p	CLIP-seq
MIRT1269691	hsa-miR-543	CLIP-seq
MIRT2079263	hsa-miR-3065-3p	CLIP-seq
MIRT1269691	hsa-miR-543	CLIP-seq
MIRT2305605	hsa-miR-3143	CLIP-seq
MIRT2305606	hsa-miR-4659a-3p	CLIP-seq
MIRT2305607	hsa-miR-4659b-3p	CLIP-seq
MIRT2305608	hsa-miR-4778-3p	CLIP-seq
MIRT2305609	hsa-miR-496	CLIP-seq
MIRT1269691	hsa-miR-543	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IEA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IBA
GO:0007565	Process	Female pregnancy	NAS	3260773
GO:0009986	Component	Cell surface	IBA
GO:0016477	Process	Cell migration	NAS	3260773

Other IDs

• MIM: 176391
• HGNC: 9519
• e!Ensembl: ENSG00000242221

Protein

• UniProt ID: P11465
• Protein name: Pregnancy-specific beta-1-glycoprotein 2 (PS-beta-G-2) (PSBG-2) (Pregnancy-specific glycoprotein 2) (Pregnancy-specific beta-1 glycoprotein E) (PS-beta-E)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	38 → 139	Immunoglobulin V-set domain	Domain
  PF13927	Ig_3	148 → 221		Domain
  PF13895	Ig_2	241 → 320	Immunoglobulin domain	Domain

• Sequence:

  MGPLSAPPCTEHIKWKGLLVTASLLNFWNLPTTAQVTIEAQPPKVSEGKDVLLLVHNLPQ
  NLTGYIWYKGQIRDLYHYITSYVVDGQIIIYGPAYSGRETAYSNASLLIQNVTREDAGSY
  TLHIIKRGDGTRGVTGYFTFTLYLETPKPSISSSNLNPREAMETVILTCDPETPDTSYQW
  WMNGQSLPMTHRFQLSETNRTLFLFGVTKYTAGPYECEIRNSGSASRSDPVTLNLLHGPD
  LPRIHPSYTNYRSGDNLYLSCFANSNPPAQYSWTINGKFQQSGQNLFIPQITTKHSGLYV
  CSVRNSATGEESSTSLTVKVSASTRIGLLPLLNPT

• Sequence length: 335

Pathways

Reactome:

Cell surface interactions at the vascular wall

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA OF GALLBLADDER AND EXTRAHEPATIC BILIARY TRACT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma	Associate	25884453	★☆☆☆☆ Found in Text Mining only
Adenoma	Associate	27100181	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	24228128	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	35799670	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	25884453	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Associate	34907179	★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Associate	27100181	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Associate	12100028	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	24618180, 26497206, 27100181, 31420913	★☆☆☆☆ Found in Text Mining only
Cysts	Associate	18587325	★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Stimulate	23522976	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Associate	34119530	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	22151235	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	17992052	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	12100028, 9406053	★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	20816019	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	30326857	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	24419231, 29157747	★☆☆☆☆ Found in Text Mining only
Polycystic liver disease	Associate	18587325	★☆☆☆☆ Found in Text Mining only
Pre Eclampsia	Associate	31284791, 35322669	★☆☆☆☆ Found in Text Mining only
Sinonasal undifferentiated carcinoma	Associate	32818509	★☆☆☆☆ Found in Text Mining only