ERO1B (endoplasmic reticulum oxidoreductase 1 beta)

Gene

• Entrez ID: 56605
• Gene name: Endoplasmic reticulum oxidoreductase 1 beta
• Gene symbol: ERO1B
• Synonyms (NCBI Gene): ERO1LB, Ero1beta
• Chromosome: 1
• Chromosome location: 1q42.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT440709	hsa-miR-376a-3p	HITS-CLIP	24374217
MIRT440708	hsa-miR-432-5p	HITS-CLIP	24374217
MIRT440706	hsa-miR-1185-2-3p	HITS-CLIP	24374217
MIRT440707	hsa-miR-376c-3p	HITS-CLIP	24374217
MIRT440705	hsa-miR-1185-1-3p	HITS-CLIP	24374217
MIRT440709	hsa-miR-376a-3p	HITS-CLIP	24374217
MIRT440708	hsa-miR-432-5p	HITS-CLIP	24374217
MIRT440706	hsa-miR-1185-2-3p	HITS-CLIP	24374217
MIRT440707	hsa-miR-376c-3p	HITS-CLIP	24374217
MIRT440705	hsa-miR-1185-1-3p	HITS-CLIP	24374217

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	20802462
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	TAS	10818100
GO:0005788	Component	Endoplasmic reticulum lumen	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006457	Process	Protein folding	TAS	10818100
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IEA
GO:0015035	Function	Protein-disulfide reductase activity	EXP	11707400, 16407158, 21091435
GO:0015035	Function	Protein-disulfide reductase activity	IBA
GO:0015035	Function	Protein-disulfide reductase activity	IEA
GO:0015036	Function	Disulfide oxidoreductase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016491	Function	Oxidoreductase activity	NAS	10818100
GO:0016972	Function	Thiol oxidase activity	IDA	21091435
GO:0016972	Function	Thiol oxidase activity	IEA
GO:0030070	Process	Insulin processing	IEA
GO:0030070	Process	Insulin processing	TAS
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0034975	Process	Protein folding in endoplasmic reticulum	IBA
GO:0034975	Process	Protein folding in endoplasmic reticulum	IDA	21091435
GO:0034975	Process	Protein folding in endoplasmic reticulum	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0045454	Process	Cell redox homeostasis	IEA
GO:0051082	Function	Unfolded protein binding	NAS	10818100
GO:0051604	Process	Protein maturation	IEA
GO:0071949	Function	FAD binding	IEA

Other IDs

• MIM: 615437
• HGNC: 14355
• e!Ensembl: ENSG00000086619

Protein

• UniProt ID: Q86YB8
• Protein name: ERO1-like protein beta (ERO1-L-beta) (EC 1.8.4.-) (Endoplasmic reticulum oxidoreductase beta) (Endoplasmic reticulum oxidoreductin-1-like protein B) (Oxidoreductin-1-L-beta)
• Protein function: Oxidoreductase involved in disulfide bond formation in the endoplasmic reticulum. Efficiently reoxidizes P4HB/PDI, the enzyme catalyzing protein disulfide formation, in order to allow P4HB to sustain additional rounds of disulfide formation. Oth
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04137	ERO1	56 → 456	Endoplasmic Reticulum Oxidoreductin 1 (ERO1)	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in the digestive tract, including the duodenum and lower digestive tract. In the stomach, highly expressed in enzyme-producing chief cells (at protein level). In the pancreas, expressed in islets of Langerhans and, at
• Sequence:

  MSQGVRRAGAGQGVAAAVQLLVTLSFLRSVVEAQVTGVLDDCLCDIDSIDNFNTYKIFPK
  IKKLQERDYFRYYKVNLKRPCPFWAEDGHCSIKDCHVEPCPESKIPVGIKAGHSNKYLKM
  ANNTKELEDCEQANKLGAINSTLSNQSKEAFIDWARYDDSRDHFCELDDERSPAAQYVDL
  LLNPERYTGYKGTSAWRVWNSIYEENCFKPRSVYRPLNPLAPSRGEDDGESFYTWLEGLC
  LEKRVFYKLISGLHASINLHLCANYLLEETWGKPSWGPNIKEFKHRFDPVETKGEGPRRL
  KNLYFLYLIELRALSKVAPYFERSIVDLYTGNAEEDADTKTLLLNIFQDTKSFPMHFDEK
  SMFAGDKKGAKSLKEEFRLHFKNISRIMDCVGCDKCRLWGKLQTQGLGTALKILFSEKEI
  QKLPENSPSKGFQLTRQEIVALLNAFGRLSTSIRDLQNFKVLLQHSR

• Sequence length: 467

Pathways

KEGG:

Protein processing in endoplasmic reticulum

Reactome:

Insulin processing

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Developmental cataract	Uncertain significance	rs966390978	RCV001376652
Gastric cancer	Uncertain significance	rs966390978	RCV005910802

Associations from Text Mining
Disease Name	Relationship Type	References
Adenocarcinoma of Lung	Associate	32235589
Diabetes Mellitus Type 2	Associate	36109769
Esophageal Neoplasms	Associate	35568702
Pancreatic Neoplasms	Associate	28177904