PRTN3 (proteinase 3)

Gene

• Entrez ID: 5657
• Gene name: Proteinase 3
• Gene symbol: PRTN3
• Synonyms (NCBI Gene): ACPA, AGP7, C-ANCA, CANCA, MBN, MBT, NP-4, NP4, P29, PR-3, PR3
• Chromosome: 19
• Chromosome location: 19p13.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1268885	hsa-miR-342-5p	CLIP-seq
MIRT1268886	hsa-miR-4461	CLIP-seq
MIRT1268887	hsa-miR-4651	CLIP-seq
MIRT1268888	hsa-miR-4664-5p	CLIP-seq
MIRT1268889	hsa-miR-608	CLIP-seq
MIRT2078995	hsa-miR-4449	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SPI1	Unknown	10677505

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	EXP	11389039
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IDA	28240246
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	IMP	22266279, 23202369
GO:0005102	Function	Signaling receptor binding	IPI	17244676
GO:0005515	Function	Protein binding	IPI	16488976, 28240246, 30692621
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005829	Component	Cytosol	IDA	17712045
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	17244676, 18462208, 21193407, 22266279, 28240246
GO:0005886	Component	Plasma membrane	IDA	17712045
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IDA	28240246
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	IMP	22266279
GO:0006509	Process	Membrane protein ectodomain proteolysis	IMP	23202369
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	TAS	2679910
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	2598267
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019730	Process	Antimicrobial humoral response	TAS
GO:0019899	Function	Enzyme binding	IPI	17712045
GO:0030574	Process	Collagen catabolic process	IEA
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0035578	Component	Azurophil granule lumen	IDA	18462208
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0043547	Process	Positive regulation of GTPase activity	IMP	23202369
GO:0044853	Component	Plasma membrane raft	IDA	21193407
GO:0045121	Component	Membrane raft	IEA
GO:0045217	Process	Cell-cell junction maintenance	IMP	23202369
GO:0050765	Process	Negative regulation of phagocytosis	IDA	17712045
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0072672	Process	Neutrophil extravasation	IMP	22266279
GO:0097029	Process	Mature conventional dendritic cell differentiation	IDA	16478888

Other IDs

• MIM: 177020
• HGNC: 9495
• e!Ensembl: ENSG00000196415

Protein

• UniProt ID: P24158
• Protein name: Myeloblastin (EC 3.4.21.76) (AGP7) (C-ANCA antigen) (Leukocyte proteinase 3) (PR-3) (PR3) (Neutrophil proteinase 4) (NP-4) (P29) (Wegener autoantigen)
• Protein function: Serine protease that degrades elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV (in vitro) (PubMed:2033050, PubMed:28240246, PubMed:3198760). By cleaving and activating receptor F2RL1/PAR-2, enhances endothelial cell
• PDB: 1FUJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	28 → 243	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in polymorphonuclear leukocytes (at protein level) (PubMed:2033050, PubMed:3198760, PubMed:7897245). Expressed in neutrophils (at protein level) (PubMed:17244676, PubMed:18462208, PubMed:21193407, PubMed:22266279, PubMed:2824
• Sequence:

  MAHRPPSPALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTL
  IHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVL
  LIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTF
  FCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYV
  DWIRSTLRRVEAKGRP

• Sequence length: 256

Pathways

Reactome:

Common Pathway of Fibrin Clot Formation
Other interleukin signaling
Neutrophil degranulation
Antimicrobial peptides