MMP26 (matrix metallopeptidase 26)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 56547
Gene name Matrix metallopeptidase 26
Gene symbol MMP26
Synonyms (NCBI Gene)
-
Chromosome 11
Chromosome location 11p15.4
Summary Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as art
miRNA miRNA information provided by mirtarbase database.
10
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (10)
miRTarBase ID miRNA Experiments Reference
MIRT022618 hsa-miR-124-3p Microarray 18668037
MIRT731486 hsa-miR-125b-5p Luciferase reporter assay 27143441
MIRT731486 hsa-miR-125b-5p Luciferase reporter assay 27143441
MIRT731486 hsa-miR-125b-5p Luciferase reporter assay 27143441
MIRT1153497 hsa-miR-33a CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (17)
GO ID Ontology Definition Evidence Reference
GO:0004222 Function Metalloendopeptidase activity IBA
GO:0004222 Function Metalloendopeptidase activity IEA
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0006508 Process Proteolysis IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
605470 14249 ENSG00000167346
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NRE1
Protein name Matrix metalloproteinase-26 (MMP-26) (EC 3.4.24.-) (Endometase) (Matrilysin-2)
Protein function May hydrolyze collagen type IV, fibronectin, fibrinogen, beta-casein, type I gelatin and alpha-1 proteinase inhibitor. Is also able to activate progelatinase B.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00413 Peptidase_M10 98 → 253 Matrixin Domain
Tissue specificity TISSUE SPECIFICITY: Expressed specifically in uterus and placenta. Is also widely expressed in malignant tumors from different sources as well as in diverse tumor cell lines.
Sequence 
MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQ
FHRNGTDLLDMQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAV
KDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSG
NPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQL
SADDIQRIQHLYGEKCSSDIP
Sequence length 261
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Myoepithelial tumor Uncertain significance rs376216232 RCV002463916
Show/Hide Text Mining Associations (30)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 39879518
Breast Neoplasms Associate 11389678, 17176253, 19895737
Calcifying Epithelial Odontogenic Tumor Associate 21903428
Carcinogenesis Associate 15816845, 16641547
Carcinoma Associate 16641547
Carcinoma Hepatocellular Stimulate 25091573
Carcinoma Non Small Cell Lung Associate 19448419, 25566961
Chondrosarcoma Associate 25262277
Colonic Diseases Stimulate 19895737
Colorectal Neoplasms Stimulate 24318970