MMP26 (matrix metallopeptidase 26)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
56547
Gene name Gene Name - the full gene name approved by the HGNC.
Matrix metallopeptidase 26
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MMP26
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p15.4
Summary Summary of gene provided in NCBI Entrez Gene.
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as art
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(10)
miRTarBase ID miRNA Experiments Reference
MIRT022618 hsa-miR-124-3p Microarray 18668037
MIRT731486 hsa-miR-125b-5p Luciferase reporter assay 27143441
MIRT731486 hsa-miR-125b-5p Luciferase reporter assay 27143441
MIRT731486 hsa-miR-125b-5p Luciferase reporter assay 27143441
MIRT1153497 hsa-miR-33a CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(7)
GO ID Ontology Definition Evidence Reference
GO:0004222 Function Metalloendopeptidase activity IBA 21873635
GO:0006508 Process Proteolysis NAS 10987280
GO:0008270 Function Zinc ion binding IEA
GO:0030198 Process Extracellular matrix organization IBA 21873635
GO:0030574 Process Collagen catabolic process IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
605470 14249 ENSG00000167346
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9NRE1
Protein name Matrix metalloproteinase-26 (MMP-26) (EC 3.4.24.-) (Endometase) (Matrilysin-2)
Protein function May hydrolyze collagen type IV, fibronectin, fibrinogen, beta-casein, type I gelatin and alpha-1 proteinase inhibitor. Is also able to activate progelatinase B.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00413 Peptidase_M10 98 → 253 Matrixin Domain
Tissue specificity TISSUE SPECIFICITY: Expressed specifically in uterus and placenta. Is also widely expressed in malignant tumors from different sources as well as in diverse tumor cell lines.
Sequence 
MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQ
FHRNGTDLLDMQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAV
KDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSG
NPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQL
SADDIQRIQHLYGEKCSSDIP
Sequence length 261
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Narcolepsy Narcolepsy rs104894574, rs387906655 19629137
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Coenzyme Q10 Deficiency Coenzyme Q10 Deficiency GWAS
Show/Hide Text Mining Associations (30)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 39879518
Breast Neoplasms Associate 11389678, 17176253, 19895737
Calcifying Epithelial Odontogenic Tumor Associate 21903428
Carcinogenesis Associate 15816845, 16641547
Carcinoma Associate 16641547
Carcinoma Hepatocellular Stimulate 25091573
Carcinoma Non Small Cell Lung Associate 19448419, 25566961
Chondrosarcoma Associate 25262277
Colonic Diseases Stimulate 19895737
Colorectal Neoplasms Stimulate 24318970