KLK6 (kallikrein related peptidase 6)

Gene

• Entrez ID: 5653
• Gene name: Kallikrein related peptidase 6
• Gene symbol: KLK6
• Synonyms (NCBI Gene): Bssp, Klk7, PRSS18, PRSS9, SP59, hK6
• Chromosome: 19
• Chromosome location: 19q13.41
• Summary: This gene encodes a member of the kallikrein subfamily of the peptidase S1 family of serine proteases. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. T

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004678	hsa-let-7f-5p	ELISA, Luciferase reporter assay, qRT-PCR	18627289
MIRT1099056	hsa-miR-1290	CLIP-seq
MIRT1099057	hsa-miR-3074-5p	CLIP-seq
MIRT1099058	hsa-miR-3135	CLIP-seq
MIRT1099059	hsa-miR-3154	CLIP-seq
MIRT1099060	hsa-miR-4742-3p	CLIP-seq
MIRT1099061	hsa-miR-486-5p	CLIP-seq
MIRT1099062	hsa-miR-630	CLIP-seq
MIRT1099063	hsa-miR-1285	CLIP-seq
MIRT1099064	hsa-miR-3187-5p	CLIP-seq
MIRT1099065	hsa-miR-3612	CLIP-seq
MIRT1099066	hsa-miR-4487	CLIP-seq
MIRT1099067	hsa-miR-4645-3p	CLIP-seq
MIRT1099068	hsa-miR-4722-5p	CLIP-seq
MIRT1099069	hsa-miR-4768-3p	CLIP-seq
MIRT1099070	hsa-miR-4779	CLIP-seq
MIRT1099071	hsa-miR-503	CLIP-seq
MIRT1099072	hsa-miR-612	CLIP-seq
MIRT1099073	hsa-miR-650	CLIP-seq
MIRT2026896	hsa-let-7a	CLIP-seq
MIRT2026897	hsa-let-7b	CLIP-seq
MIRT2026898	hsa-let-7c	CLIP-seq
MIRT2026899	hsa-let-7d	CLIP-seq
MIRT2026900	hsa-let-7e	CLIP-seq
MIRT2026901	hsa-let-7f	CLIP-seq
MIRT2026902	hsa-let-7g	CLIP-seq
MIRT2026903	hsa-let-7i	CLIP-seq
MIRT2026904	hsa-miR-1293	CLIP-seq
MIRT2026905	hsa-miR-342-5p	CLIP-seq
MIRT2026906	hsa-miR-3927	CLIP-seq
MIRT2026907	hsa-miR-4458	CLIP-seq
MIRT2026908	hsa-miR-4483	CLIP-seq
MIRT2026909	hsa-miR-4500	CLIP-seq
MIRT2026910	hsa-miR-4536	CLIP-seq
MIRT2026911	hsa-miR-4651	CLIP-seq
MIRT2026912	hsa-miR-4664-5p	CLIP-seq
MIRT2026913	hsa-miR-4676-5p	CLIP-seq
MIRT2026914	hsa-miR-4717-3p	CLIP-seq
MIRT2026915	hsa-miR-575	CLIP-seq
MIRT2026916	hsa-miR-576-3p	CLIP-seq
MIRT2026917	hsa-miR-608	CLIP-seq
MIRT2026918	hsa-miR-98	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001533	Component	Cornified envelope	IEA
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IDA	16885167
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	NAS	12878203
GO:0005515	Function	Protein binding	IPI	12709365, 12878203, 32814053
GO:0005576	Component	Extracellular region	IDA	11668196
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	11668196
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0007417	Process	Central nervous system development	NAS	12589961
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0009611	Process	Response to wounding	NAS	12016211
GO:0010975	Process	Regulation of neuron projection development	IEA
GO:0016540	Process	Protein autoprocessing	NAS	12878203
GO:0016787	Function	Hydrolase activity	IEA
GO:0030141	Component	Secretory granule	IBA
GO:0030574	Process	Collagen catabolic process	NAS	12878203
GO:0031965	Component	Nuclear membrane	IDA
GO:0042246	Process	Tissue regeneration	NAS	12878203
GO:0042445	Process	Hormone metabolic process	NAS	11668196
GO:0042552	Process	Myelination	NAS	11668196
GO:0042982	Process	Amyloid precursor protein metabolic process	NAS	12709365
GO:0045171	Component	Intercellular bridge	IDA
GO:0045595	Process	Regulation of cell differentiation	NAS	11668196
GO:0045745	Process	Positive regulation of G protein-coupled receptor signaling pathway	IDA	16885167
GO:0051604	Process	Protein maturation	IBA

Other IDs

• MIM: 602652
• HGNC: 6367
• e!Ensembl: ENSG00000167755

Protein

• UniProt ID: Q92876
• Protein name: Kallikrein-6 (EC 3.4.21.-) (Neurosin) (Protease M) (SP59) (Serine protease 18) (Serine protease 9) (Zyme)
• Protein function: Serine protease which exhibits a preference for Arg over Lys in the substrate P1 position and for Ser or Pro in the P2 position. Shows activity against amyloid precursor protein, myelin basic protein, gelatin, casein and extracellular matrix pro
• PDB: 1GVL, 1L2E, 1LO6, 3VFE, 4D8N, 5NX1, 5NX3, 6QFF, 6QFG, 6QFH, 6QH9, 6QHA, 6QHB, 6QHC, 6SKB, 6SKC, 6SKD, 7QFT, 7QFV, 7QHZ, 7QI0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	22 → 237	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: In fluids, highest levels found in milk of lactating women followed by cerebrospinal fluid, nipple aspirate fluid and breast cyst fluid. Also found in serum, seminal plasma and some amniotic fluids and breast tumor cytosolic extracts.
• Sequence:

  MKKLMVVLSLIAAAWAEEQNKLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTA
  AHCKKPNLQVFLGKHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSE
  LIQPLPLERDCSANTTSCHILGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNM
  LCAGDEKYGKDSCQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVYTNVCRYTNWIQKT
  IQAK

• Sequence length: 244

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMYELINATING DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEWY BODY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBORRHEIC DERMATITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SHY-DRAGER SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma	Associate	21656738	★☆☆☆☆ Found in Text Mining only
Adenoma Pleomorphic	Associate	30120721	★☆☆☆☆ Found in Text Mining only
Alcoholism	Associate	24890784	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	10997858, 12016211, 29378650, 33633844	★☆☆☆☆ Found in Text Mining only
Ascites	Associate	16557045, 35883559	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Associate	26231762	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Inhibit	15627893	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Inhibit	12087468, 14710225, 15627893	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	17656355, 27093921, 29934309	★☆☆☆☆ Found in Text Mining only
Calcinosis Cutis	Associate	21753781	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	40428321	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	19426157	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Associate	19707197	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Associate	18854834	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Stimulate	36610378	★☆☆☆☆ Found in Text Mining only
Carcinoma Papillary	Stimulate	15867230	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	16340244	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	32158625, 37575065	★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Associate	15557757, 15627893	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Disease Mineral and Bone Disorder	Associate	28784837	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Associate	15015574, 24430362, 29393333, 31370719, 35883559	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Stimulate	15015574, 24430362, 34065672	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	18283336, 19367279, 21656738, 35883559, 40156045	★☆☆☆☆ Found in Text Mining only
Death	Inhibit	23049835	★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Associate	15557757	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diarrhea 5 With Tufting Enteropathy Congenital	Associate	29224812	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Associate	33633844	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Stimulate	30758105	★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Associate	34301297	★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Stimulate	35462765	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	22477710, 23307575, 26231762, 39684695	★☆☆☆☆ Found in Text Mining only
Glioma	Inhibit	19661345	★☆☆☆☆ Found in Text Mining only
Glioma	Associate	26231762	★☆☆☆☆ Found in Text Mining only
Gliosis	Associate	23307575	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Associate	25990935	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Stimulate	27844409	★☆☆☆☆ Found in Text Mining only
Heart Failure	Associate	29784904	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Stimulate	18359858	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	17823117	★☆☆☆☆ Found in Text Mining only
Laryngeal Diseases	Associate	35462765	★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Associate	23308173, 25476568	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Stimulate	24430362	★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	21753781, 22032772, 27844409	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	15557757, 29934309, 34065672	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Stimulate	19707197	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Inhibit	35462765	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	12016211, 15015574, 15557757, 15627893, 16557045, 17459052, 17823117, 18854834, 18957059, 19426157, 19707197, 22436421, 22477710, 23307575, 23587030, 25990935, 26231762, 27844409, 29229980, 30287916, 31675166, 35462765, 35883559, 36610378, 39684695	★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	12624183, 18283336, 21656738, 22373580, 24430362, 29934309, 31370719, 34065672	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	27093921	★☆☆☆☆ Found in Text Mining only
Neoplasms Cystic Mucinous and Serous	Stimulate	25477184	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Associate	17823117, 29378650, 31675166, 40428321	★☆☆☆☆ Found in Text Mining only
Obesity	Inhibit	29784904	★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Associate	29890994	★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Associate	25990935	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Inhibit	12016211	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	12624183, 18957059, 19383346, 19707197, 20037204, 20132413, 22505521, 27483364, 30287916	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Stimulate	15305183, 15557757, 17242704, 20800559, 25477184	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Stimulate	15015574	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	15477757	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Associate	10997858, 23308173, 26497684	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peritonitis	Stimulate	35883559	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	22874102	★☆☆☆☆ Found in Text Mining only
Retinal Dysplasia	Associate	35462765	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Associate	40428321	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	25990935, 29224812	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stimulate	22373580	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	23587030	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Inhibit	23049835	★☆☆☆☆ Found in Text Mining only
Synucleinopathies	Associate	23308173	★☆☆☆☆ Found in Text Mining only
Tarlov Cysts	Stimulate	23587030	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	17459052	★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Associate	15785748, 15867230	★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Associate	35974070	★☆☆☆☆ Found in Text Mining only