Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
56479
Gene name Gene Name - the full gene name approved by the HGNC.
Potassium voltage-gated channel subfamily Q member 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KCNQ5
Synonyms (NCBI Gene) Gene synonyms aliases
Kv7.5, MRD46
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the KCNQ potassium channel gene family that is differentially expressed in subregions of the brain and in skeletal muscle. The protein encoded by this gene yields currents that activate slowly with depolarization and can form hete
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1135401955 T>G Pathogenic Coding sequence variant, missense variant
rs1135401956 C>A Pathogenic Coding sequence variant, missense variant
rs1135401957 G>T Pathogenic Intron variant, genic downstream transcript variant, coding sequence variant, missense variant
rs1135401958 C>A,G Pathogenic Coding sequence variant, missense variant
rs1554201137 C>T Likely-pathogenic Coding sequence variant, stop gained
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT054652 hsa-miR-190a-5p Luciferase reporter assay, Western blot 24446351
MIRT710021 hsa-miR-4282 HITS-CLIP 19536157
MIRT710020 hsa-miR-6507-5p HITS-CLIP 19536157
MIRT710016 hsa-miR-101-3p HITS-CLIP 19536157
MIRT710019 hsa-miR-144-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005216 Function Monoatomic ion channel activity IEA
GO:0005249 Function Voltage-gated potassium channel activity IBA
GO:0005249 Function Voltage-gated potassium channel activity IDA 10787416, 11159685, 24855057
GO:0005249 Function Voltage-gated potassium channel activity IEA
GO:0005249 Function Voltage-gated potassium channel activity IMP 28669405
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607357 6299 ENSG00000185760
Protein
UniProt ID Q9NR82
Protein name Potassium voltage-gated channel subfamily KQT member 5 (KQT-like 5) (Potassium channel subunit alpha KvLQT5) (Voltage-gated potassium channel subunit Kv7.5)
Protein function Pore-forming subunit of the voltage-gated potassium (Kv) channel broadly expressed in brain and involved in the regulation of neuronal excitability (PubMed:10787416, PubMed:10816588, PubMed:11159685, PubMed:28669405). Associates with KCNQ3/Kv7.3
PDB 6B8Q
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00520 Ion_trans 125 358 Ion transport protein Family
PF03520 KCNQ_channel 447 634 KCNQ voltage-gated potassium channel Family
Tissue specificity TISSUE SPECIFICITY: Strongly expressed in brain and skeletal muscle (PubMed:10787416, PubMed:10816588). In brain, expressed in cerebral cortex, occipital pole, frontal lobe and temporal lobe. Lower levels in hippocampus and putamen. Low to undetectable le
Sequence
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLL
LGTRAATLGGGGGGLRESRRGKQGARMSLLGKPLSYTSSQSCRRNVKYRRVQNYLYNVLE
RPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRYRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQIL
RMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFSSFLVYLVEKDANKEFSTYAD
ALWWGTITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPAGILGSGFALKVQEQH
RQ
KHFEKRRNPAANLIQCVWRSYAADEKSVSIATWKPHLKALHTCSPTKKEQGEASSSQKLS
FKERVRMASPRGQSIKSRQASVGDRRSPSTDITAEGSPTKVQKSWSFNDRTRFRPSLRLK
SSQPKPVIDADTALGTDDVYDEKGCQCDVSVEDLTPPLKTVIRAIRIMKFHVAKRKFKET
LRPYDVKDVIEQYSAGHLDMLCRIKSLQTRVDQILGKGQITSDKKSREKITAEHETTDDL
SMLGRVVKVEKQVQSIESKLDCLLDIYQQVLRKG
SASALALASFQIPPFECEQTSDYQSP
VDSKDLSGSAQNSGCLSRSTSANISRGLQFILTPNEFSAQTFYALSPTMHSQATQVPISQ
SDGSAVAATNTIANQINTAPKPAAPTTLQIPPPLPAIKHLPRPETLHPNPAGLQESISDV
TTCLVASKENVQVAQSNLTKDRSMRKSFDMGGETLLSVCPMVPKDLGKSLSVQNLIRSTE
ELNIQLSGSESSGSRGSQDFYPKWRESKLFITDEEVGPEETETDTFDAAPQPAREAAFAS
DSLRTGRSRSSQSICKAGESTDALSLPHVKLK
Sequence length 932
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cholinergic synapse   Voltage gated Potassium channels
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Mental retardation Intellectual disability, autosomal dominant 46 rs1135401955, rs1135401956, rs1135401957, rs1135401958, rs1554201137 N/A
Developmental Delay global developmental delay rs1554210415 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dementia Dementia N/A N/A GWAS
Glioblastoma Glioblastoma N/A N/A GWAS
Hyperopia Hyperopia N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Allergic Fungal Sinusitis Associate 24595210
Amyotrophic Lateral Sclerosis Associate 33417599
Autism Spectrum Disorder Associate 37407249
Autistic Disorder Associate 29904178
Brain Diseases Associate 28669405
Colorectal Neoplasms Associate 23975090, 31727158, 33892797
Depressive Disorder Treatment Resistant Associate 28669405
Developmental Disabilities Associate 29904178
Diarrhea Associate 25127363
Disease Associate 25127363, 33417599