Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	56478
Gene name Gene Name - the full gene name approved by the HGNC.	Eukaryotic translation initiation factor 4E nuclear import factor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	EIF4ENIF1
Synonyms (NCBI Gene) Gene synonyms aliases	4E-T, Clast4
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q12.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a nucleocytoplasmic shuttle protein for the translation initiation factor eIF4E. This shuttle protein interacts with the importin alpha-beta complex to mediate nuclear import of eIF4E. It is predominantly cytoplasmic; i

Show/Hide all(53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017657	hsa-miR-335-5p	Microarray	18185580
MIRT039552	hsa-miR-652-3p	CLASH	23622248
MIRT038736	hsa-miR-93-3p	CLASH	23622248
MIRT1984009	hsa-miR-3613-3p	CLIP-seq
MIRT1984010	hsa-miR-3924	CLIP-seq
MIRT2219231	hsa-miR-377	CLIP-seq
MIRT2219232	hsa-miR-1182	CLIP-seq
MIRT2219233	hsa-miR-382	CLIP-seq
MIRT2219234	hsa-miR-4672	CLIP-seq
MIRT2219235	hsa-miR-4789-5p	CLIP-seq
MIRT2448764	hsa-miR-3973	CLIP-seq
MIRT2448765	hsa-miR-548a-5p	CLIP-seq
MIRT2448766	hsa-miR-548ab	CLIP-seq
MIRT2448767	hsa-miR-548ak	CLIP-seq
MIRT2448768	hsa-miR-548b-5p	CLIP-seq
MIRT2448769	hsa-miR-548c-5p	CLIP-seq
MIRT2448770	hsa-miR-548d-5p	CLIP-seq
MIRT2448771	hsa-miR-548h	CLIP-seq
MIRT2448772	hsa-miR-548i	CLIP-seq
MIRT2448773	hsa-miR-548j	CLIP-seq
MIRT2448774	hsa-miR-548w	CLIP-seq
MIRT2448775	hsa-miR-548y	CLIP-seq
MIRT2448776	hsa-miR-559	CLIP-seq
MIRT2522464	hsa-miR-1324	CLIP-seq
MIRT2522465	hsa-miR-3074-3p	CLIP-seq
MIRT2522466	hsa-miR-3129-3p	CLIP-seq
MIRT2522467	hsa-miR-3156-5p	CLIP-seq
MIRT2522468	hsa-miR-324-5p	CLIP-seq
MIRT2522469	hsa-miR-337-3p	CLIP-seq
MIRT1984009	hsa-miR-3613-3p	CLIP-seq
MIRT2522470	hsa-miR-3667-3p	CLIP-seq
MIRT1984010	hsa-miR-3924	CLIP-seq
MIRT2522471	hsa-miR-4289	CLIP-seq
MIRT2522472	hsa-miR-4650-5p	CLIP-seq
MIRT2522473	hsa-miR-4742-3p	CLIP-seq
MIRT2522474	hsa-miR-4754	CLIP-seq
MIRT2522475	hsa-miR-4793-5p	CLIP-seq
MIRT2522476	hsa-miR-486-5p	CLIP-seq
MIRT2522477	hsa-miR-549	CLIP-seq
MIRT2522478	hsa-miR-630	CLIP-seq
MIRT2522479	hsa-miR-642b	CLIP-seq
MIRT2522480	hsa-miR-889	CLIP-seq
MIRT2522464	hsa-miR-1324	CLIP-seq
MIRT2522467	hsa-miR-3156-5p	CLIP-seq
MIRT2522468	hsa-miR-324-5p	CLIP-seq
MIRT2522470	hsa-miR-3667-3p	CLIP-seq
MIRT2522471	hsa-miR-4289	CLIP-seq
MIRT2522473	hsa-miR-4742-3p	CLIP-seq
MIRT2522474	hsa-miR-4754	CLIP-seq
MIRT2522475	hsa-miR-4793-5p	CLIP-seq
MIRT2522476	hsa-miR-486-5p	CLIP-seq
MIRT2522477	hsa-miR-549	CLIP-seq
MIRT2522478	hsa-miR-630	CLIP-seq

Show/Hide all(40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000932	Component	P-body	IDA	16157702, 22966201, 23991149, 24335285, 32354837
GO:0000932	Component	P-body	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003729	Function	MRNA binding	IBA
GO:0003729	Function	MRNA binding	IEA
GO:0005049	Function	Nuclear export signal receptor activity	IDA	10856257
GO:0005515	Function	Protein binding	IPI	10856257, 16157702, 16189514, 16467844, 16699599, 16713569, 18985028, 19060904, 21516116, 23991149, 24335285, 24981860, 25416956, 25910212, 26184334, 27342281, 28487484, 28514442, 28698298, 29510985, 31422817, 31439631, 32296183, 32814053, 33961781, 35271311, 39251607
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	28216671
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	10856257
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	28216671
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	10856257
GO:0005829	Component	Cytosol	IEA
GO:0006412	Process	Translation	IEA
GO:0006417	Process	Regulation of translation	IEA
GO:0006606	Process	Protein import into nucleus	IDA	28216671
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016605	Component	PML body	IEA
GO:0016607	Component	Nuclear speck	IEA
GO:0017148	Process	Negative regulation of translation	IBA
GO:0017148	Process	Negative regulation of translation	IDA	24335285, 27342281
GO:0017148	Process	Negative regulation of translation	IEA
GO:0017148	Process	Negative regulation of translation	IMP	16157702
GO:0019827	Process	Stem cell population maintenance	IEA
GO:0019900	Function	Kinase binding	IPI	22966201
GO:0030182	Process	Neuron differentiation	IEA
GO:0031047	Process	Regulatory ncRNA-mediated gene silencing	IEA
GO:0033962	Process	P-body assembly	IDA	22966201, 27342281
GO:0033962	Process	P-body assembly	IMP	16157702
GO:0035278	Process	MiRNA-mediated gene silencing by inhibition of translation	IDA	24335285, 27342281, 28487484, 32354837
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0048255	Process	MRNA stabilization	IDA	24335285, 32354837
GO:0051168	Process	Nuclear export	IEA
GO:0060213	Process	Positive regulation of nuclear-transcribed mRNA poly(A) tail shortening	IDA	32354837
GO:0106289	Process	Negative regulation of deadenylation-dependent decapping of nuclear-transcribed mRNA	IDA	32354837

MIM	HGNC	e!Ensembl
607445	16687	ENSG00000184708

Protein

UniProt ID

Q9NRA8

Protein name

Eukaryotic translation initiation factor 4E transporter (4E-T) (eIF4E transporter) (Eukaryotic translation initiation factor 4E nuclear import factor 1)

Protein function

EIF4E-binding protein that regulates translation and stability of mRNAs in processing bodies (P-bodies) (PubMed:16157702, PubMed:24335285, PubMed:27342281, PubMed:32354837). Plays a key role in P-bodies to coordinate the storage of translational

PDB

5ANR , 6F9W , 6X2R

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10477	EIF4E-T	30 → 711	Nucleocytoplasmic shuttling protein for mRNA cap-binding EIF4E	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10856257}.

Sequence

MDRRSMGETESGDAFLDLKKPPASKCPHRYTKEELLDIKELPHSKQRPSCLSEKYDSDGV
WDPEKWHASLYPASGRSSPVESLKKELDTDRPSLVRRIVDPRERVKEDDLDVVLSPQRRS
FGGGCHVTAAVSSRRSGSPLEKDSDGLRLLGGRRIGSGRIISARTFEKDHRLSDKDLRDL
RDRDRERDFKDKRFRREFGDSKRVFGERRRNDSYTEEEPEWFSAGPTSQSETIELTGFDD
KILEEDHKGRKRTRRRTASVKEGIVECNGGVAEEDEVEVILAQEPAADQEVPRDAVLPEQ
SPGDFDFNEFFNLDKVPCLASMIEDVLGEGSVSASRFSRWFSNPSRSGSRSSSLGSTPHE
ELERLAGLEQAILSPGQNSGNYFAPIPLEDHAENKVDILEMLQKAKVDLKPLLSSLSANK
EKLKESSHSGVVLSVEEVEAGLKGLKVDQQVKNSTPFMAEHLEETLSAVTNNRQLKKDGD
MTAFNKLVSTMKASGTLPSQPKVSRNLESHLMSPAEIPGQPVPKNILQELLGQPVQRPAS
SNLLSGLMGSLEPTTSLLGQRAPSPPLSQVFQTRAASADYLRPRIPSPIGFTPGPQQLLG
DPFQGMRKPMSPITAQMSQLELQQAALEGLALPHDLAVQAANFYQPGFGKPQVDRTRDGF
RNRQQRVTKSPAPVHRGNSSSPAPAASITSMLSPSFTPTSVIRKMYESKEKSKEEPASGK
AALGDSKEDTQKASEENLLSSSSVPSADRDSSPTTNSKLSALQRSSCSTPLSQANRYTKE
QDYRPKATGRKTPTLASPVPTTPFLRPVHQVPLVPHVPMVRPAHQLHPGLVQRMLAQGVH
PQHLPSLLQTGVLPPGMDLSHLQGISGPILGQPFYPLPAASHPLLNPRPGTPLHLAMVQQ
QLQRSVLHPPGSGSHAAAVSVQTTPQNVPSRSGLPHMHSQLEHRPSQRSSSPVGLAKWFG
SDVLQQPLPSMPAKVISVDELEYRQ

Sequence length

985

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Colorectal Cancer	Colorectal cancer	N/A	N/A	GWAS

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Ovarian Diseases	Associate	31810472
Primary Ovarian Insufficiency	Associate	23902945, 31810472
Pulmonary edema of mountaineers	Associate	28242600

EIF4ENIF1 (eukaryotic translation initiation factor 4E nuclear import factor 1)