Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
56475
Gene name Gene Name - the full gene name approved by the HGNC.
Reprimo, TP53 dependent G2 arrest mediator homolog
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RPRM
Synonyms (NCBI Gene) Gene synonyms aliases
REPRIMO
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q23.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT551305 hsa-miR-548m PAR-CLIP 21572407
MIRT551304 hsa-miR-4678 PAR-CLIP 21572407
MIRT551303 hsa-miR-6887-3p PAR-CLIP 21572407
MIRT551302 hsa-miR-4749-3p PAR-CLIP 21572407
MIRT458459 hsa-miR-5197-3p PAR-CLIP 23592263
Transcription factors
Transcription factor Regulation Reference
FOXA1 Repression 19917725
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
GO:0005737 Component Cytoplasm TAS 10930422
GO:0007346 Process Regulation of mitotic cell cycle IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612171 24201 ENSG00000177519
Protein
UniProt ID Q9NS64
Protein name Protein reprimo
Protein function May be involved in the regulation of p53-dependent G2 arrest of the cell cycle. Seems to induce cell cycle arrest by inhibiting CDK1 activity and nuclear translocation of the CDC2 cyclin B1 complex (By similarity).
Family and domains
Sequence
MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA
VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY
Sequence length 109
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  p53 signaling pathway  
<