RPRM (reprimo, TP53 dependent G2 arrest mediator homolog)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
56475
Gene name Gene Name - the full gene name approved by the HGNC.
Reprimo, TP53 dependent G2 arrest mediator homolog
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RPRM
Synonyms (NCBI Gene) Gene synonyms aliases
REPRIMO
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q23.3
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(71)
miRTarBase ID miRNA Experiments Reference
MIRT551305 hsa-miR-548m PAR-CLIP 21572407
MIRT551304 hsa-miR-4678 PAR-CLIP 21572407
MIRT551303 hsa-miR-6887-3p PAR-CLIP 21572407
MIRT551302 hsa-miR-4749-3p PAR-CLIP 21572407
MIRT458459 hsa-miR-5197-3p PAR-CLIP 23592263
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
FOXA1 Repression 19917725
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(5)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005737 Component Cytoplasm IBA 21873635
GO:0007050 Process Cell cycle arrest IEA
GO:0007346 Process Regulation of mitotic cell cycle IBA 21873635
GO:0016021 Component Integral component of membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
612171 24201 ENSG00000177519
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9NS64
Protein name Protein reprimo
Protein function May be involved in the regulation of p53-dependent G2 arrest of the cell cycle. Seems to induce cell cycle arrest by inhibiting CDK1 activity and nuclear translocation of the CDC2 cyclin B1 complex (By similarity).
Family and domains
Sequence 
MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA
VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY
Sequence length 109
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  
  p53 signaling pathway  
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Esophagus neoplasm Esophageal Neoplasms, Malignant neoplasm of esophagus rs28934578, rs121918714, rs1567556006, rs1575166666 17121882
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Barrett esophagus Barrett Esophagus 17121882 ClinVar
Show/Hide Text Mining Associations (10)
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 26796959, 28809778
Carcinogenesis Associate 16752411
Carcinoma Pancreatic Ductal Associate 16752411
Carcinoma Renal Cell Associate 20154727
Neoplasms Associate 20154727, 25954972, 26796959, 28809778
Neoplasms Inhibit 27992600, 40244164
Pancreatic Intraductal Neoplasms Associate 18157091
Pancreatic Neoplasms Associate 16752411
Stomach Neoplasms Associate 20178103, 25954972, 26823831, 27528034, 27992600, 35549646, 40244164
Uterine Cervical Dysplasia Associate 16752411