RPRM (reprimo, TP53 dependent G2 arrest mediator homolog)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID 56475
Gene name Reprimo, TP53 dependent G2 arrest mediator homolog
Gene symbol RPRM
Synonyms (NCBI Gene)
REPRIMO
Chromosome 2
Chromosome location 2q23.3
miRNA miRNA information provided by mirtarbase database.
71
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (71)
miRTarBase ID miRNA Experiments Reference
MIRT551305 hsa-miR-548m PAR-CLIP 21572407
MIRT551304 hsa-miR-4678 PAR-CLIP 21572407
MIRT551303 hsa-miR-6887-3p PAR-CLIP 21572407
MIRT551302 hsa-miR-4749-3p PAR-CLIP 21572407
MIRT458459 hsa-miR-5197-3p PAR-CLIP 23592263
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (1)
Transcription factor Regulation Reference
FOXA1 Repression 19917725
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (9)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
GO:0005737 Component Cytoplasm TAS 10930422
GO:0007346 Process Regulation of mitotic cell cycle IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
612171 24201 ENSG00000177519
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NS64
Protein name Protein reprimo
Protein function May be involved in the regulation of p53-dependent G2 arrest of the cell cycle. Seems to induce cell cycle arrest by inhibiting CDK1 activity and nuclear translocation of the CDC2 cyclin B1 complex (By similarity).
Family and domains
Sequence 
MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA
VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY
Sequence length 109
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
  KEGG 
  p53 signaling pathway