PRRG2 (proline rich and Gla domain 2)

Gene

• Entrez ID: 5639
• Gene name: Proline rich and Gla domain 2
• Gene symbol: PRRG2
• Synonyms (NCBI Gene): PRGP2
• Chromosome: 19
• Chromosome location: 19q13.33
• Summary: The protein encoded by this gene is a single-pass transmembrane protein containing an N-terminal gamma-carboxyglutamic acid (Gla) domain and tandem Pro/Leu-Pro-Xaa-Tyr (PY) motifs at its C-terminal end. The Gla domain is exposed on the cell surface while

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017531	hsa-miR-335-5p	Microarray	18185580
MIRT1267915	hsa-miR-2909	CLIP-seq
MIRT1267916	hsa-miR-4267	CLIP-seq
MIRT1267917	hsa-miR-4278	CLIP-seq
MIRT1267918	hsa-miR-508-5p	CLIP-seq
MIRT1267919	hsa-miR-766	CLIP-seq
MIRT2078782	hsa-miR-2355-5p	CLIP-seq
MIRT2078783	hsa-miR-3145-5p	CLIP-seq
MIRT2078784	hsa-miR-3691-3p	CLIP-seq
MIRT1267916	hsa-miR-4267	CLIP-seq
MIRT2078785	hsa-miR-4286	CLIP-seq
MIRT2602180	hsa-miR-1343	CLIP-seq
MIRT2602181	hsa-miR-378g	CLIP-seq
MIRT2602182	hsa-miR-4437	CLIP-seq
MIRT2602183	hsa-miR-4492	CLIP-seq
MIRT2602184	hsa-miR-4498	CLIP-seq
MIRT2602185	hsa-miR-4505	CLIP-seq
MIRT2602186	hsa-miR-4508	CLIP-seq
MIRT2602187	hsa-miR-4674	CLIP-seq
MIRT2602188	hsa-miR-762	CLIP-seq
MIRT2602180	hsa-miR-1343	CLIP-seq
MIRT2602181	hsa-miR-378g	CLIP-seq
MIRT2602182	hsa-miR-4437	CLIP-seq
MIRT2602183	hsa-miR-4492	CLIP-seq
MIRT2602184	hsa-miR-4498	CLIP-seq
MIRT2602185	hsa-miR-4505	CLIP-seq
MIRT2602186	hsa-miR-4508	CLIP-seq
MIRT2602187	hsa-miR-4674	CLIP-seq
MIRT2602188	hsa-miR-762	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	17502622, 25283809
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	17502622
GO:0005887	Component	Integral component of plasma membrane	TAS	9256434

Other IDs

• MIM: 604429
• HGNC: 9470
• e!Ensembl: ENSG00000126460

Protein

• UniProt ID: O14669
• Protein name: Transmembrane gamma-carboxyglutamic acid protein 2 (Proline-rich gamma-carboxyglutamic acid protein 2) (Proline-rich Gla protein 2)
• PDB: 9BVP, 9BVQ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00594	Gla	55 → 95	Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed with highest levels in kidney (PubMed:23873930). Also highly expressed in the thyroid (PubMed:23873930, PubMed:9256434). {ECO:0000269|PubMed:23873930, ECO:0000269|PubMed:9256434}.
• Sequence:

  MRGHPSLLLLYMALTTCLDTSPSEETDQEVFLGPPEAQSFLSSHTRIPRANHWDLELLTP
  GNLERECLEERCSWEEAREYFEDNTLTERFWESYIYNGKGGRGRVDVASLAVGLTGGILL
  IVLAGLGAFWYLRWRQHRGQQPCPQEAGLISPLSPLNPLGPPTPLPPPPPPPPGLPTYEQ
  ALAASGVHDAPPPPYTSLRRPH

• Sequence length: 202

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	31268507, 25056061, 30285260, 28991256, 26198764