Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5639
Gene name Gene Name - the full gene name approved by the HGNC.
Proline rich and Gla domain 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PRRG2
Synonyms (NCBI Gene) Gene synonyms aliases
PRGP2
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.33
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a single-pass transmembrane protein containing an N-terminal gamma-carboxyglutamic acid (Gla) domain and tandem Pro/Leu-Pro-Xaa-Tyr (PY) motifs at its C-terminal end. The Gla domain is exposed on the cell surface while
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017531 hsa-miR-335-5p Microarray 18185580
MIRT1267915 hsa-miR-2909 CLIP-seq
MIRT1267916 hsa-miR-4267 CLIP-seq
MIRT1267917 hsa-miR-4278 CLIP-seq
MIRT1267918 hsa-miR-508-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004252 Function Serine-type endopeptidase activity IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 17502622, 23873930, 25283809
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604429 9470 ENSG00000126460
Protein
UniProt ID O14669
Protein name Transmembrane gamma-carboxyglutamic acid protein 2 (Proline-rich gamma-carboxyglutamic acid protein 2) (Proline-rich Gla protein 2)
PDB 9BVP , 9BVQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00594 Gla 55 95 Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed with highest levels in kidney (PubMed:23873930). Also highly expressed in the thyroid (PubMed:23873930, PubMed:9256434). {ECO:0000269|PubMed:23873930, ECO:0000269|PubMed:9256434}.
Sequence
MRGHPSLLLLYMALTTCLDTSPSEETDQEVFLGPPEAQSFLSSHTRIPRANHWDLELLTP
GNLERECLEERCSWEEAREYFEDNTLTERFWESYI
YNGKGGRGRVDVASLAVGLTGGILL
IVLAGLGAFWYLRWRQHRGQQPCPQEAGLISPLSPLNPLGPPTPLPPPPPPPPGLPTYEQ
ALAASGVHDAPPPPYTSLRRPH
Sequence length 202
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Schizophrenia Schizophrenia N/A N/A GWAS