Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5638
Gene name Gene Name - the full gene name approved by the HGNC.
Proline rich and Gla domain 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PRRG1
Synonyms (NCBI Gene) Gene synonyms aliases
PRGP1
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xp21.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a vitamin K-dependent, gamma-carboxyglutamic acid (Gla)-containing, single-pass transmembrane protein. This protein contains a Gla domain at the N-terminus, preceded by a propeptide sequence required for post-translational gamma-carboxyl
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020483 hsa-miR-106b-5p Microarray 17242205
MIRT028084 hsa-miR-93-5p Sequencing 20371350
MIRT244944 hsa-miR-17-5p In situ hybridization, Next Generation Sequencing (NGS), qRT-PCR 26233958
MIRT244945 hsa-miR-20a-5p In situ hybridization, Next Generation Sequencing (NGS), qRT-PCR 26233958
MIRT1267821 hsa-miR-103a CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004252 Function Serine-type endopeptidase activity IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300935 9469 ENSG00000130962
Protein
UniProt ID O14668
Protein name Transmembrane gamma-carboxyglutamic acid protein 1 (Proline-rich gamma-carboxyglutamic acid protein 1) (Proline-rich Gla protein 1)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00594 Gla 25 65 Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in the spinal cord.
Sequence
MGRVFLTGEKANSILKRYPRANGFFEEIRQGNIERECKEEFCTFEEAREAFENNEKTKEF
WSTYT
KAQQGESNRGSDWFQFYLTFPLIFGLFIILLVIFLIWRCFLRNKTRRQTVTEGHI
PFPQHLNIITPPPPPDEVFDSSGLSPGFLGYVVGRSDSVSTRLSNCDPPPTYEEATGQVN
LQRSETEPHLDPPPEYEDIVNSNSASAIPMVPVVTTIK
Sequence length 218
Interactions View interactions
<