PROX1 (prospero homeobox 1)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5629
Gene name Gene Name - the full gene name approved by the HGNC.
Prospero homeobox 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PROX1
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q32.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the homeobox transcription factor family. Members of this family contain a homeobox domain that consists of a 60-amino acid helix-turn-helix structure that binds DNA and RNA. The protein encoded by this gene
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(75)
miRTarBase ID miRNA Experiments Reference
MIRT003630 hsa-miR-181a-5p Luciferase reporter assay, qRT-PCR, Western blot 20558617
MIRT003630 hsa-miR-181a-5p Luciferase reporter assay, qRT-PCR, Western blot 20558617
MIRT018128 hsa-miR-335-5p Microarray 18185580
MIRT019318 hsa-miR-148b-3p Microarray 17612493
MIRT037355 hsa-miR-877-5p CLASH 23622248
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(4)
Transcription factor Regulation Reference
HEY1 Repression 22719258
NFKB1 Activation 19901262
PAX6 Activation 11554737
RELA Activation 19901262
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(78)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 15205472
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription regulatory region sequence-specific DNA binding IDA 19210544
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
601546 9459 ENSG00000117707
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
UniProt ID Q92786
Protein name Prospero homeobox protein 1 (Homeobox prospero-like protein PROX1) (PROX-1)
Protein function Transcription factor involved in developmental processes such as cell fate determination, gene transcriptional regulation and progenitor cell regulation in a number of organs. Plays a critical role in embryonic development and functions as a key
PDB 2LMD
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05044 HPD 579 → 732 Homeo-prospero domain Domain
Tissue specificity TISSUE SPECIFICITY: Most actively expressed in the developing lens. Detected also in embryonic brain, lung, liver and kidney. In adult, it is more abundant in heart and liver than in brain, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:8812486
Sequence 
MPDHDSTALLSRQTKRRRVDIGVKRTVGTASAFFAKARATFFSAMNPQGSEQDVEYSVVQ
HADGEKSNVLRKLLKRANSYEDAMMPFPGATIISQLLKNNMNKNGGTEPSFQASGLSSTG
SEVHQEDICSNSSRDSPPECLSPFGRPTMSQFDMDRLCDEHLRAKRARVENIIRGMSHSP
SVALRGNENEREMAPQSVSPRESYRENKRKQKLPQQQQQSFQQLVSARKEQKREERRQLK
QQLEDMQKQLRQLQEKFYQIYDSTDSENDEDGNLSEDSMRSEILDARAQDSVGRSDNEMC
ELDPGQFIDRARALIREQEMAENKPKREGNNKERDHGPNSLQPEGKHLAETLKQELNTAM
SQVVDTVVKVFSAKPSRQVPQVFPPLQIPQARFAVNGENHNFHTANQRLQCFGDVIIPNP
LDTFGNVQMASSTDQTEALPLVVRKNSSDQSASGPAAGGHHQPLHQSPLSATTGFTTSTF
RHPFPLPLMAYPFQSPLGAPSGSFSGKDRASPESLDLTRDTTSLRTKMSSHHLSHHPCSP
AHPPSTAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSS
NMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCE
LYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSE
VPEIFKSPNCLQELLHE
Sequence length 737
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Diabetes mellitus Diabetes Mellitus, Non-Insulin-Dependent rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)		 20081858, 30595370, 22885922, 30054458, 28869590, 29358691
Show/Hide Unknown Diseases (7)
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Schizophrenia Schizophrenia GWAS
Obesity Obesity GWAS
Metabolic Syndrome Metabolic Syndrome GWAS
Show/Hide Text Mining Associations (80)
Associations from Text Mining
Disease Name Relationship Type References
Acquired Immunodeficiency Syndrome Associate 20064070
Adenocarcinoma Associate 22067331, 22143938
Adenocarcinoma Follicular Associate 31060342
Albuminuria Associate 28060188
Astrocytoma Associate 27626492
Brain Neoplasms Associate 27626492
Breast Neoplasms Associate 29059430, 38206773
Carcinogenesis Associate 18455124, 25526434, 27411302, 31060342
Carcinoma Hepatocellular Associate 18400094, 22023334
Carcinoma Non Small Cell Lung Associate 37925421