Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
56287
Gene name Gene Name - the full gene name approved by the HGNC.
Gastrokine 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GKN1
Synonyms (NCBI Gene) Gene synonyms aliases
AMP18, BRICD1, CA11, FOV, foveolin
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is found to be down-regulated in human gastric cancer tissue as compared to normal gastric mucosa. [provided by RefSeq, Jul 2008]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029935 hsa-miR-26b-5p Microarray 19088304
MIRT755391 hsa-miR-548d-3p Luciferase reporter assay, qRT-PCR 35666636
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003674 Function Molecular_function ND
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005575 Component Cellular_component ND
GO:0005615 Component Extracellular space IBA 21873635
GO:0007586 Process Digestion NAS 10835488
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606402 23217 ENSG00000169605
Protein
UniProt ID Q9NS71
Protein name Gastrokine-1 (18 kDa antrum mucosa protein) (AMP-18) (Protein CA11)
Protein function Has mitogenic activity and may be involved in maintaining the integrity of the gastric mucosal epithelium.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04089 BRICHOS 70 163 BRICHOS domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in stomach (at protein level). No expression is detected in cancer tissue or gastric cancer cell lines. {ECO:0000269|PubMed:10835488, ECO:0000269|PubMed:12851218, ECO:0000269|PubMed:15221938}.
Sequence
MLAYSSVHCFREDKMKFTIVFAGLLGVFLAPALANYNINVNDDNNNAGSGQQSVSVNNEH
NVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKL
QGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYM
AEEMQEASLFFYSGTCY
TTSVLWIVDISFCGDTVEN
Sequence length 199
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Adenocarcinoma Adenocarcinoma, Adenocarcinoma, Basal Cell, Adenocarcinoma, Oxyphilic, Adenocarcinoma, Tubular rs121913530, rs886039394, rs121913474 15378696
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Carcinoma Carcinoma, Cribriform, Carcinoma, Granular Cell rs121912654, rs555607708, rs786202962, rs1564055259 15378696
Gastric cancer Hereditary Diffuse Gastric Cancer rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802
View all (244 more)
15378696
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 38250608
Atrophy Inhibit 18927498
Barrett Esophagus Associate 17636545
Gastritis Inhibit 18927498, 22798109
Helicobacter Infections Inhibit 18593995, 22798109
Helicobacter Infections Associate 23317277
Inflammation Associate 18927498
Inflammation Stimulate 23444260
Intestinal Diseases Inhibit 18927498
Intestinal Neoplasms Inhibit 18593995