GKN1 (gastrokine 1)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 56287
Gene name Gastrokine 1
Gene symbol GKN1
Synonyms (NCBI Gene)
AMP18BRICD1CA11FOVfoveolin
Chromosome 2
Chromosome location 2p13.3
Summary The protein encoded by this gene is found to be down-regulated in human gastric cancer tissue as compared to normal gastric mucosa. [provided by RefSeq, Jul 2008]
miRNA miRNA information provided by mirtarbase database.
2
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (2)
miRTarBase ID miRNA Experiments Reference
MIRT029935 hsa-miR-26b-5p Microarray 19088304
MIRT755391 hsa-miR-548d-3p Luciferase reporter assayqRT-PCR 35666636
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (15)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005576 Component Extracellular region IDA 15221938
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
606402 23217 ENSG00000169605
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NS71
Protein name Gastrokine-1 (18 kDa antrum mucosa protein) (AMP-18) (Protein CA11)
Protein function Has mitogenic activity and may be involved in maintaining the integrity of the gastric mucosal epithelium.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04089 BRICHOS 70 → 163 BRICHOS domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in stomach (at protein level). No expression is detected in cancer tissue or gastric cancer cell lines. {ECO:0000269|PubMed:10835488, ECO:0000269|PubMed:12851218, ECO:0000269|PubMed:15221938}.
Sequence 
MLAYSSVHCFREDKMKFTIVFAGLLGVFLAPALANYNINVNDDNNNAGSGQQSVSVNNEH
NVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKL
QGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCY
TTSVLWIVDISFCGDTVEN
Sequence length 199
Interactions View interactions