Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
56270
Gene name Gene Name - the full gene name approved by the HGNC.
WD repeat domain 45B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
WDR45B
Synonyms (NCBI Gene) Gene synonyms aliases
NEDSBAS, WDR45L, WIPI-3, WIPI3
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q25.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the WIPI or SVP1 family of WD40 repeat-containing proteins. The protein contains seven WD40 repeats that are thought to fold into a beta-propeller structure that mediates protein-protein interactions, and a conserved motif fo
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs786205510 G>A Pathogenic, likely-pathogenic Coding sequence variant, non coding transcript variant, stop gained
rs1555647262 G>A Pathogenic Stop gained, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT039009 hsa-miR-766-3p CLASH 23622248
MIRT037428 hsa-miR-744-5p CLASH 23622248
MIRT491941 hsa-miR-19b-3p PAR-CLIP 20371350
MIRT491940 hsa-miR-19a-3p PAR-CLIP 20371350
MIRT491939 hsa-miR-595 PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000045 Process Autophagosome assembly IMP 28561066
GO:0000407 Component Phagophore assembly site IDA 28561066
GO:0000407 Component Phagophore assembly site IEA
GO:0000422 Process Autophagy of mitochondrion IBA
GO:0000425 Process Pexophagy IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609226 25072 ENSG00000141580
Protein
UniProt ID Q5MNZ6
Protein name WD repeat domain phosphoinositide-interacting protein 3 (WIPI-3) (WD repeat-containing protein 45-like) (WDR45-like protein) (WD repeat-containing protein 45B) (WIPI49-like protein)
Protein function Component of the autophagy machinery that controls the major intracellular degradation process by which cytoplasmic materials are packaged into autophagosomes and delivered to lysosomes for degradation (PubMed:28561066). Binds phosphatidylinosit
PDB 6IYY , 6KLR , 8ZQG , 9C9I , 9CE3
Family and domains
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. Highly expressed in heart, skeletal muscle and pancreas. Up-regulated in a variety of tumor tissues including ovarian and uterine cancers. {ECO:0000269|PubMed:15602573}.
Sequence
MNLLPCNPHGNGLLYAGFNQDHGCFACGMENGFRVYNTDPLKEKEKQEFLEGGVGHVEML
FRCNYLALVGGGKKPKYPPNKVMIWDDLKKKTVIEIEFSTEVKAVKLRRDRIVVVLDSMI
KVFTFTHNPHQLHVFETCYNPKGLCVLCPNSNNSLLAFPGTHTGHVQLVDLASTEKPPVD
IPAHEGVLSCIALNLQGTRIATASEKGTLIRIFDTSSGHLIQELRRGSQAANIYCINFNQ
DASLICVSSDHGTVHIFAAEDPKRNKQSSLASASFLPKYFSSKWSFSKFQVPSGSPCICA
FGTEPNAVIAICADGSYYKFLFNPKGECIRDVYAQFLEMTDDKL
Sequence length 344
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Autophagy - animal   Macroautophagy
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Neurodevelopmental Disorder With Spastic Quadriplegia And Brain Abnormalities With Or Without Seizures neurodevelopmental disorder with spastic quadriplegia and brain abnormalities with or without seizures rs786205510, rs1555647262 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Cardiomyopathy Right Ventricular Dilated Associate 35322404
Central Nervous System Vascular Malformations Associate 35322404
Congenital disorder of glycosylation type 2A Associate 35322404
Developmental Disabilities Associate 35322404
Heredodegenerative Disorders Nervous System Associate 33636118
Intellectual Disability Associate 33636118
Microcephaly Associate 35322404
Quadriplegia Associate 35322404
Seizures Associate 35322404
Tooth Loss Associate 35322404