CPXM1 (carboxypeptidase X, M14 family member 1)

Gene

• Entrez ID: 56265
• Gene name: Carboxypeptidase X, M14 family member 1
• Gene symbol: CPXM1
• Synonyms (NCBI Gene): CPX1, CPXM
• Chromosome: 20
• Chromosome location: 20p13
• Summary: This gene likely encodes a member of the carboxypeptidase family of proteins. Cloning of a comparable locus in mouse indicates that the encoded protein contains a discoidin domain and a carboxypeptidase domain, but the protein appears to lack residues nec

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT907810	hsa-miR-1236	CLIP-seq
MIRT907811	hsa-miR-1247	CLIP-seq
MIRT907812	hsa-miR-3127-3p	CLIP-seq
MIRT907813	hsa-miR-3183	CLIP-seq
MIRT907814	hsa-miR-4684-5p	CLIP-seq
MIRT907815	hsa-miR-4723-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004180	Function	Carboxypeptidase activity	IEA
GO:0004181	Function	Metallocarboxypeptidase activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 609555
• HGNC: 15771
• e!Ensembl: ENSG00000088882

Protein

• UniProt ID: Q96SM3
• Protein name: Probable carboxypeptidase X1 (EC 3.4.17.-) (Metallocarboxypeptidase CPX-1)
• Protein function: May be involved in cell-cell interactions. No carboxypeptidase activity was found yet (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00754	F5_F8_type_C	130 → 271	F5/8 type C domain	Domain
  PF00246	Peptidase_M14	305 → 613	Zinc carboxypeptidase	Domain
  PF13620	CarboxypepD_reg	624 → 701		Domain

• Sequence:

  MWGLLLALAAFAPAVGPALGAPRNSVLGLAQPGTTKVPGSTPALHSSPAQPPAETANGTS
  EQHVRIRVIKKKKVIMKKRKKLTLTRPTPLVTAGPLVTPTPAGTLDPAEKQETGCPPLGL
  ESLRVSDSRLEASSSQSFGLGPHRGRLNIQSGLEDGDLYDGAWCAEEQDADPWFQVDAGH
  PTRFSGVITQGRNSVWRYDWVTSYKVQFSNDSRTWWGSRNHSSGMDAVFPANSDPETPVL
  NLLPEPQVARFIRLLPQTWLQGGAPCLRAEILACPVSDPNDLFLEAPASGSSDPLDFQHH
  NYKAMRKLMKQVQEQCPNITRIYSIGKSYQGLKLYVMEMSDKPGEHELGEPEVRYVAGMH
  GNEALGRELLLLLMQFLCHEFLRGNPRVTRLLSEMRIHLLPSMNPDGYEIAYHRGSELVG
  WAEGRWNNQSIDLNHNFADLNTPLWEAQDDGKVPHIVPNHHLPLPTYYTLPNATVAPETR
  AVIKWMKRIPFVLSANLHGGELVVSYPFDMTRTPWAARELTPTPDDAVFRWLSTVYAGSN
  LAMQDTSRRPCHSQDFSVHGNIINGADWHTVPGSMNDFSYLHTNCFEVTVELSCDKFPHE
  NELPQEWENNKDALLTYLEQVRMGIAGVVRDKDTELGIADAVIAVDGINHDVTTAWGGDY
  WRLLTPGDYMVTASAEGYHSVTRNCRVTFEEGPFPCNFVLTKTPKQRLRELLAAGAKVPP
  DLRRRLERLRGQKD

• Sequence length: 734

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Breast Neoplasms	Associate	27993161, 30072699, 33499882	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Associate	36948524	★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	32078680	★☆☆☆☆ Found in Text Mining only
Linitis Plastica	Associate	36450891	★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	36224027	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Associate	32078680	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	30072699, 36948524	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Stimulate	33253093	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Associate	30072699	★☆☆☆☆ Found in Text Mining only