Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5626
Gene name Gene Name - the full gene name approved by the HGNC.
PROP paired-like homeobox 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PROP1
Synonyms (NCBI Gene) Gene synonyms aliases
CPHD2, PROP-1
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q35.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a paired-like homeodomain transcription factor in the developing pituitary gland. Expression occurs prior to and is required for expression of pou domain transcription factor 1, which is responsible for pituitary development and hormone
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121917839 G>A Likely-pathogenic Coding sequence variant, missense variant
rs121917840 A>G,T Likely-pathogenic Coding sequence variant, missense variant
rs121917841 A>G Pathogenic Coding sequence variant, missense variant
rs121917842 C>T Pathogenic Coding sequence variant, missense variant
rs121917843 G>A Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT731114 hsa-miR-593-3p Western blot, Luciferase reporter assay 25434367
MIRT731114 hsa-miR-593-3p Western blot, Luciferase reporter assay 25434367
MIRT731114 hsa-miR-593-3p Western blot, Luciferase reporter assay 25434367
MIRT731114 hsa-miR-593-3p Western blot, Luciferase reporter assay 25434367
MIRT731115 hsa-miR-511-5p Western blot, Luciferase reporter assay 25434367
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601538 9455 ENSG00000175325
Protein
UniProt ID O75360
Protein name Homeobox protein prophet of Pit-1 (PROP-1) (Pituitary-specific homeodomain factor)
Protein function Possibly involved in the ontogenesis of pituitary gonadotropes, as well as somatotropes, lactotropes and caudomedial thyrotropes.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 70 126 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed specifically in embryonic pituitary.
Sequence
MEAERRRQAEKPKKGRVGSNLLPERHPATGTPTTTVDSSAPPCRRLPGAGGGRSRFSPQG
GQRGRPHSRRRHRTTFSPVQLEQLESAFGRNQYPDIWARESLARDTGLSEARIQVWFQNR
RAKQRK
QERSLLQPLAHLSPAAFSSFLPESTACPYSYAAPPPPVTCFPHPYSHALPSQPS
TGGAFALSHQSEDWYPTLHPAPAGHLPCPPPPPMLPLSLEPSKSWN
Sequence length 226
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Pituitary adenoma Pituitary hormone deficiency, combined, 2 rs762529663, rs1554182481, rs587776682, rs1057517027, rs1554182645, rs587776683, rs1057517041, rs1554182405, rs121917842, rs1057516832, rs1554182632, rs121917843, rs1057517424, rs1214465435, rs121917844
View all (16 more)
N/A
46, XY partial gonadal dysgenesis 46,xy partial gonadal dysgenesis rs193922688 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenoma Stimulate 23778486
Adrenocorticotropic hormone deficiency Associate 17162714, 31948187
Amenorrhea Associate 23624138, 36984475
Cardiomegaly Associate 17698542, 30988269
Chromosome Aberrations Associate 34124982
Combined Pituitary Hormone Deficiency Associate 12153609, 15302300, 17162714, 17698542, 22111336, 23624138, 23652424, 26059845, 26608600, 28356564, 29255988, 30988269, 31948187, 32612575, 36984475
View all (1 more)
Craniopharyngioma Associate 22086512
Developmental Disabilities Associate 23624138
Dwarfism Pituitary Associate 22111336, 23652424, 30988269, 31948187
Follicle stimulating hormone deficiency isolated Associate 17162714