Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
56253
Gene name Gene Name - the full gene name approved by the HGNC.
Cytotoxic and regulatory T cell molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CRTAM
Synonyms (NCBI Gene) Gene synonyms aliases
CD355
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q24.1
Summary Summary of gene provided in NCBI Entrez Gene.
The CRTAM gene is upregulated in CD4 (see MIM 186940)-positive and CD8 (see CD8A; MIM 186910)-positive T cells and encodes a type I transmembrane protein with V and C1-like Ig domains (Yeh et al., 2008 [PubMed 18329370]).[supplied by OMIM, Feb 2009]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018919 hsa-miR-335-5p Microarray 18185580
MIRT030104 hsa-miR-26b-5p Microarray 19088304
MIRT910565 hsa-miR-122 CLIP-seq
MIRT910566 hsa-miR-1245 CLIP-seq
MIRT910567 hsa-miR-129-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001768 Process Establishment of T cell polarity IEA
GO:0001768 Process Establishment of T cell polarity ISS
GO:0001772 Component Immunological synapse IEA
GO:0001772 Component Immunological synapse ISS
GO:0001819 Process Positive regulation of cytokine production IDA 15811952
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612597 24313 ENSG00000109943
Protein
UniProt ID O95727
Protein name Cytotoxic and regulatory T-cell molecule (Class-I MHC-restricted T-cell-associated molecule) (CD antigen CD355)
Protein function Mediates heterophilic cell-cell adhesion which regulates the activation, differentiation and tissue retention of various T-cell subsets (By similarity). Interaction with CADM1 promotes natural killer (NK) cell cytotoxicity and IFNG/interferon-ga
PDB 3RBG , 4H5S
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 21 115 Immunoglobulin V-set domain Domain
PF08205 C2-set_2 121 207 CD80-like C2-set immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: In the immune system, expression is restricted to activated class-I MHC-restricted cells, including NKT and CD8 T-cells (PubMed:10811014, PubMed:15811952, PubMed:16300832). Strongly expressed in spleen, thymus, small intestine, periphe
Sequence
MWWRVLSLLAWFPLQEASLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFL
NEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVL
ATPFK
PILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTT
STLIIHTYGKNSTVDCIIRHRGLQGRK
LVAPFRFEDLVTDEETASDALERNSLSSQDPQQ
PTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKSGILLLTLVSFLIFI
LFIIVQLFIMKLRKAHVIWKKENEVSEHTLESYRSRSNNEETSSEEKNGQSSHPMRCMNY
ITKLYSEAKTKRKENVQHSKLEEKHIQVPESIV
Sequence length 393
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dementia Dementia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Amyotrophic Lateral Sclerosis Associate 40033250
Asthma Associate 22051697
Infections Associate 27105228
Status Asthmaticus Associate 22051697