Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	56253
Gene name	Cytotoxic and regulatory T cell molecule
Gene symbol	CRTAM
Synonyms (NCBI Gene)	CD355
Chromosome	11
Chromosome location	11q24.1
Summary	The CRTAM gene is upregulated in CD4 (see MIM 186940)-positive and CD8 (see CD8A; MIM 186910)-positive T cells and encodes a type I transmembrane protein with V and C1-like Ig domains (Yeh et al., 2008 [PubMed 18329370]).[supplied by OMIM, Feb 2009]

134

Show/Hide all (134)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018919	hsa-miR-335-5p	Microarray	18185580
MIRT030104	hsa-miR-26b-5p	Microarray	19088304
MIRT910565	hsa-miR-122	CLIP-seq
MIRT910566	hsa-miR-1245	CLIP-seq
MIRT910567	hsa-miR-129-5p	CLIP-seq
MIRT910568	hsa-miR-2113	CLIP-seq
MIRT910569	hsa-miR-3135b	CLIP-seq
MIRT910570	hsa-miR-3180-5p	CLIP-seq
MIRT910571	hsa-miR-3187-3p	CLIP-seq
MIRT910572	hsa-miR-3189-3p	CLIP-seq
MIRT910573	hsa-miR-3622b-5p	CLIP-seq
MIRT910574	hsa-miR-3652	CLIP-seq
MIRT910575	hsa-miR-3663-5p	CLIP-seq
MIRT910576	hsa-miR-4253	CLIP-seq
MIRT910577	hsa-miR-4260	CLIP-seq
MIRT910578	hsa-miR-4268	CLIP-seq
MIRT910579	hsa-miR-4312	CLIP-seq
MIRT910580	hsa-miR-4423-5p	CLIP-seq
MIRT910581	hsa-miR-4430	CLIP-seq
MIRT910582	hsa-miR-4435	CLIP-seq
MIRT910583	hsa-miR-4701-5p	CLIP-seq
MIRT910584	hsa-miR-4710	CLIP-seq
MIRT910585	hsa-miR-4755-3p	CLIP-seq
MIRT910586	hsa-miR-4781-3p	CLIP-seq
MIRT910587	hsa-miR-4792	CLIP-seq
MIRT910588	hsa-miR-486-3p	CLIP-seq
MIRT910589	hsa-miR-490-5p	CLIP-seq
MIRT910590	hsa-miR-515-5p	CLIP-seq
MIRT910591	hsa-miR-548c-3p	CLIP-seq
MIRT910592	hsa-miR-548s	CLIP-seq
MIRT910593	hsa-miR-550a	CLIP-seq
MIRT910594	hsa-miR-588	CLIP-seq
MIRT910565	hsa-miR-122	CLIP-seq
MIRT1969930	hsa-miR-1267	CLIP-seq
MIRT910567	hsa-miR-129-5p	CLIP-seq
MIRT910569	hsa-miR-3135b	CLIP-seq
MIRT910571	hsa-miR-3187-3p	CLIP-seq
MIRT910574	hsa-miR-3652	CLIP-seq
MIRT910575	hsa-miR-3663-5p	CLIP-seq
MIRT1969931	hsa-miR-3672	CLIP-seq
MIRT1969932	hsa-miR-411	CLIP-seq
MIRT1969933	hsa-miR-4287	CLIP-seq
MIRT910580	hsa-miR-4423-5p	CLIP-seq
MIRT910581	hsa-miR-4430	CLIP-seq
MIRT910582	hsa-miR-4435	CLIP-seq
MIRT1969934	hsa-miR-4469	CLIP-seq
MIRT1969935	hsa-miR-4685-3p	CLIP-seq
MIRT910583	hsa-miR-4701-5p	CLIP-seq
MIRT910584	hsa-miR-4710	CLIP-seq
MIRT910585	hsa-miR-4755-3p	CLIP-seq
MIRT910586	hsa-miR-4781-3p	CLIP-seq
MIRT910587	hsa-miR-4792	CLIP-seq
MIRT1969936	hsa-miR-4797-5p	CLIP-seq
MIRT1969937	hsa-miR-483-5p	CLIP-seq
MIRT910592	hsa-miR-548s	CLIP-seq
MIRT910594	hsa-miR-588	CLIP-seq
MIRT1969938	hsa-miR-642a	CLIP-seq
MIRT2205936	hsa-miR-106a	CLIP-seq
MIRT2205937	hsa-miR-106b	CLIP-seq
MIRT910565	hsa-miR-122	CLIP-seq
MIRT1969930	hsa-miR-1267	CLIP-seq
MIRT2205938	hsa-miR-150	CLIP-seq
MIRT2205939	hsa-miR-17	CLIP-seq
MIRT2205940	hsa-miR-20a	CLIP-seq
MIRT2205941	hsa-miR-20b	CLIP-seq
MIRT2205942	hsa-miR-302a	CLIP-seq
MIRT2205943	hsa-miR-302b	CLIP-seq
MIRT2205944	hsa-miR-302c	CLIP-seq
MIRT2205945	hsa-miR-302d	CLIP-seq
MIRT2205946	hsa-miR-302e	CLIP-seq
MIRT910569	hsa-miR-3135b	CLIP-seq
MIRT2205947	hsa-miR-3159	CLIP-seq
MIRT2205948	hsa-miR-33a	CLIP-seq
MIRT2205949	hsa-miR-33b	CLIP-seq
MIRT910574	hsa-miR-3652	CLIP-seq
MIRT2205950	hsa-miR-372	CLIP-seq
MIRT2205951	hsa-miR-373	CLIP-seq
MIRT1969932	hsa-miR-411	CLIP-seq
MIRT1969933	hsa-miR-4287	CLIP-seq
MIRT910580	hsa-miR-4423-5p	CLIP-seq
MIRT910581	hsa-miR-4430	CLIP-seq
MIRT910582	hsa-miR-4435	CLIP-seq
MIRT2205952	hsa-miR-4438	CLIP-seq
MIRT1969934	hsa-miR-4469	CLIP-seq
MIRT1969935	hsa-miR-4685-3p	CLIP-seq
MIRT910584	hsa-miR-4710	CLIP-seq
MIRT2205953	hsa-miR-4777-3p	CLIP-seq
MIRT910586	hsa-miR-4781-3p	CLIP-seq
MIRT910587	hsa-miR-4792	CLIP-seq
MIRT1969936	hsa-miR-4797-5p	CLIP-seq
MIRT1969937	hsa-miR-483-5p	CLIP-seq
MIRT2205954	hsa-miR-5095	CLIP-seq
MIRT2205955	hsa-miR-519d	CLIP-seq
MIRT2205956	hsa-miR-520a-3p	CLIP-seq
MIRT2205957	hsa-miR-520b	CLIP-seq
MIRT2205958	hsa-miR-520c-3p	CLIP-seq
MIRT2205959	hsa-miR-520d-3p	CLIP-seq
MIRT2205960	hsa-miR-520e	CLIP-seq
MIRT2205961	hsa-miR-520g	CLIP-seq
MIRT2205962	hsa-miR-520h	CLIP-seq
MIRT1969938	hsa-miR-642a	CLIP-seq
MIRT2205963	hsa-miR-885-5p	CLIP-seq
MIRT2205964	hsa-miR-93	CLIP-seq
MIRT1969930	hsa-miR-1267	CLIP-seq
MIRT1969933	hsa-miR-4287	CLIP-seq
MIRT910580	hsa-miR-4423-5p	CLIP-seq
MIRT1969934	hsa-miR-4469	CLIP-seq
MIRT1969935	hsa-miR-4685-3p	CLIP-seq
MIRT1969936	hsa-miR-4797-5p	CLIP-seq
MIRT1969938	hsa-miR-642a	CLIP-seq
MIRT910565	hsa-miR-122	CLIP-seq
MIRT1969930	hsa-miR-1267	CLIP-seq
MIRT910567	hsa-miR-129-5p	CLIP-seq
MIRT910569	hsa-miR-3135b	CLIP-seq
MIRT2205948	hsa-miR-33a	CLIP-seq
MIRT2205949	hsa-miR-33b	CLIP-seq
MIRT910574	hsa-miR-3652	CLIP-seq
MIRT1969933	hsa-miR-4287	CLIP-seq
MIRT910580	hsa-miR-4423-5p	CLIP-seq
MIRT910581	hsa-miR-4430	CLIP-seq
MIRT1969934	hsa-miR-4469	CLIP-seq
MIRT2509184	hsa-miR-450b-5p	CLIP-seq
MIRT1969935	hsa-miR-4685-3p	CLIP-seq
MIRT910584	hsa-miR-4710	CLIP-seq
MIRT2509185	hsa-miR-4735-5p	CLIP-seq
MIRT2509186	hsa-miR-4775	CLIP-seq
MIRT910587	hsa-miR-4792	CLIP-seq
MIRT2509187	hsa-miR-4794	CLIP-seq
MIRT1969936	hsa-miR-4797-5p	CLIP-seq
MIRT2509188	hsa-miR-507	CLIP-seq
MIRT2509189	hsa-miR-557	CLIP-seq
MIRT2509190	hsa-miR-561	CLIP-seq
MIRT2509191	hsa-miR-590-3p	CLIP-seq
MIRT1969938	hsa-miR-642a	CLIP-seq

Show/Hide all (47)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001768	Process	Establishment of T cell polarity	IEA
GO:0001768	Process	Establishment of T cell polarity	ISS
GO:0001772	Component	Immunological synapse	IEA
GO:0001772	Component	Immunological synapse	ISS
GO:0001819	Process	Positive regulation of cytokine production	IDA	15811952
GO:0001913	Process	T cell mediated cytotoxicity	IDA	15811952
GO:0002250	Process	Adaptive immune response	IEA
GO:0002355	Process	Detection of tumor cell	IBA
GO:0002355	Process	Detection of tumor cell	IDA	15811952
GO:0002355	Process	Detection of tumor cell	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002860	Process	Positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IBA
GO:0002860	Process	Positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IDA	15811952
GO:0002860	Process	Positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IEA
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	IPI	15811952
GO:0005515	Function	Protein binding	IPI	23871486
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	15811952
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IEA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	ISS
GO:0008037	Process	Cell recognition	IBA
GO:0008037	Process	Cell recognition	IDA	15811952
GO:0008037	Process	Cell recognition	IEA
GO:0016020	Component	Membrane	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	ISS
GO:0042802	Function	Identical protein binding	IPI	23583034, 23871486
GO:0045580	Process	Regulation of T cell differentiation	IEA
GO:0045580	Process	Regulation of T cell differentiation	ISS
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IDA	15811952
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IEA
GO:0046007	Process	Negative regulation of activated T cell proliferation	IEA
GO:0046007	Process	Negative regulation of activated T cell proliferation	ISS
GO:0050798	Process	Activated T cell proliferation	IDA	15811952
GO:0050863	Process	Regulation of T cell activation	IEA
GO:0050863	Process	Regulation of T cell activation	ISS
GO:0051606	Process	Detection of stimulus	IDA	15811952
GO:0051606	Process	Detection of stimulus	IEA
GO:0097021	Process	Lymphocyte migration into lymphoid organs	IEA
GO:0097021	Process	Lymphocyte migration into lymphoid organs	ISS
GO:2001185	Process	Regulation of CD8-positive, alpha-beta T cell activation	IEA
GO:2001185	Process	Regulation of CD8-positive, alpha-beta T cell activation	ISS

MIM	HGNC	e!Ensembl
612597	24313	ENSG00000109943

O95727

Protein name

Cytotoxic and regulatory T-cell molecule (Class-I MHC-restricted T-cell-associated molecule) (CD antigen CD355)

Protein function

Mediates heterophilic cell-cell adhesion which regulates the activation, differentiation and tissue retention of various T-cell subsets (By similarity). Interaction with CADM1 promotes natural killer (NK) cell cytotoxicity and IFNG/interferon-ga

PDB

3RBG , 4H5S

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	21 → 115	Immunoglobulin V-set domain	Domain
PF08205	C2-set_2	121 → 207	CD80-like C2-set immunoglobulin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: In the immune system, expression is restricted to activated class-I MHC-restricted cells, including NKT and CD8 T-cells (PubMed:10811014, PubMed:15811952, PubMed:16300832). Strongly expressed in spleen, thymus, small intestine, periphe

Sequence

MWWRVLSLLAWFPLQEASLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFL
NEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFK
PILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTT
STLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQ
PTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKSGILLLTLVSFLIFI
LFIIVQLFIMKLRKAHVIWKKENEVSEHTLESYRSRSNNEETSSEEKNGQSSHPMRCMNY
ITKLYSEAKTKRKENVQHSKLEEKHIQVPESIV

Sequence length

393

Interactions

View interactions

	Reactome
			Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Lung cancer	Benign	rs35136295	RCV005910047
Uterine corpus endometrial carcinoma	Benign	rs35136295	RCV005910048

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Amyotrophic Lateral Sclerosis	Associate	40033250
Asthma	Associate	22051697
Infections	Associate	27105228
Status Asthmaticus	Associate	22051697

CRTAM (cytotoxic and regulatory T cell molecule)