Gene Gene information from NCBI Gene database.
Entrez ID 56180
Gene name Motile sperm domain containing 1
Gene symbol MOSPD1
Synonyms (NCBI Gene)
DJ473B4
Chromosome X
Chromosome location Xq26.3
miRNA miRNA information provided by mirtarbase database.
156
miRTarBase ID miRNA Experiments Reference
MIRT437641 hsa-miR-152-3p MicroarrayqRT-PCR 22815788
MIRT437652 hsa-miR-181a-5p MicroarrayqRT-PCR 22815788
MIRT1155748 hsa-miR-1279 CLIP-seq
MIRT1155749 hsa-miR-1305 CLIP-seq
MIRT1155750 hsa-miR-181a CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0000139 Component Golgi membrane IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300674 25235 ENSG00000101928
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UJG1
Protein name Motile sperm domain-containing protein 1
Protein function Plays a role in differentiation and/or proliferation of mesenchymal stem cells. Proposed to be involved in epithelial-to-mesenchymal transition (EMT). However, another study suggests that it is not required for EMT or stem cell self-renewal and
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00635 Motile_Sperm 16 134 MSP (Major sperm protein) domain Domain
Sequence
MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKY
VVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPS
AKEQQKEEEEKRLK
EHLTESLFFEQSFQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGD
VESLVPLYLHLSVNQKLVAAYILGLITMAILRT
Sequence length 213
Interactions View interactions