Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5618
Gene name Gene Name - the full gene name approved by the HGNC.
Prolactin receptor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PRLR
Synonyms (NCBI Gene) Gene synonyms aliases
HPRL, MFAB, RI-PRLR, hPRLrI
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5p13.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a receptor for the anterior pituitary hormone, prolactin, and belongs to the type I cytokine receptor family. Prolactin-dependent signaling occurs as the result of ligand-induced dimerization of the prolactin receptor. Several alternativ
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs72478580 T>G Conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant, non coding transcript variant
rs376188691 G>A,T Pathogenic Non coding transcript variant, coding sequence variant, synonymous variant, stop gained
rs398122522 T>C Pathogenic Non coding transcript variant, coding sequence variant, missense variant
rs754974807 G>A Pathogenic Non coding transcript variant, missense variant, coding sequence variant, intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT025183 hsa-miR-181a-5p Microarray 17612493
MIRT666815 hsa-miR-5680 HITS-CLIP 23824327
MIRT666814 hsa-miR-5579-5p HITS-CLIP 23824327
MIRT666813 hsa-miR-6832-3p HITS-CLIP 23824327
MIRT666812 hsa-miR-1249-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004896 Function Cytokine receptor activity IEA
GO:0004925 Function Prolactin receptor activity IBA
GO:0004925 Function Prolactin receptor activity IDA 10585417
GO:0004925 Function Prolactin receptor activity IEA
GO:0005515 Function Protein binding IPI 12819209, 22325776, 23048206, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
176761 9446 ENSG00000113494
Protein
UniProt ID P16471
Protein name Prolactin receptor (PRL-R)
Protein function This is a receptor for the anterior pituitary hormone prolactin (PRL). Acts as a prosurvival factor for spermatozoa by inhibiting sperm capacitation through suppression of SRC kinase activation and stimulation of AKT. Isoform 4 is unable to tran
PDB 1BP3 , 2LFG , 2N7I , 3D48 , 3MZG , 3N06 , 3N0P , 3NCB , 3NCC , 3NCE , 3NCF , 4I18
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09067 EpoR_lig-bind 22 120 Erythropoietin receptor, ligand binding Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in breast, placenta, kidney, liver and pancreas. {ECO:0000269|PubMed:11518703, ECO:0000269|PubMed:12580759}.
Sequence
MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNY
SLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVD

VTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEW
EIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWIS
VAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQD
FPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLL
SEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQ
PSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVE
SFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTP
ENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSS
KCRLQLGGLDYLDPACFTHSFH
Sequence length 622
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
Hormone signaling
PI3K-Akt signaling pathway
JAK-STAT signaling pathway
Prolactin signaling pathway
  Prolactin receptor signaling
Growth hormone receptor signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Hyperprolactinemia familial hyperprolactinemia rs398122522, rs376188691, rs754974807 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Postmenopausal breast cancer N/A N/A GWAS
Hyperthyroidism Hyperthyroidism N/A N/A GWAS
Hypothyroidism Hypothyroidism N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abortion Habitual Associate 28980840
Abortion Spontaneous Associate 28980840
Adenocarcinoma Associate 29949537
Arthritis Associate 27616146
Arthritis Psoriatic Associate 27616146
Arthritis Rheumatoid Associate 27616146
Autism Spectrum Disorder Associate 18207134
Breast Diseases Associate 18779591, 36445946
Breast Neoplasms Associate 11680708, 12698200, 16103113, 18053149, 18246042, 18681966, 18779591, 19036881, 19276348, 20826546, 21470416, 21726627, 22606260, 23159947, 23192981
View all (17 more)
Calcinosis Cutis Associate 21726627