Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5617
Gene name Gene Name - the full gene name approved by the HGNC.	Prolactin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PRL
Synonyms (NCBI Gene) Gene synonyms aliases	GHA1
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p22.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes the anterior pituitary hormone prolactin. This secreted hormone is a growth regulator for many tissues, including cells of the immune system. It may also play a role in cell survival by suppressing apoptosis, and it is essential for lact

Transcription factors

Show/Hide all(20)

Transcription factor	Regulation	Reference
CEBPA	Unknown	17187171
CEBPB	Unknown	10455153
CEBPD	Unknown	10455153
CREB1	Unknown	17187171
ERF	Repression	9822660
ETS1	Activation	12200232
ETS1	Unknown	21401636
EZH2	Unknown	21903722
FOXO1	Unknown	21401636
HDAC9	Repression	12609987
KLF12	Repression	23458459
LEF1	Unknown	17240357
LHX2	Activation	22535646
MEN1	Unknown	17024155
PITX1	Activation	16879162
PITX2	Activation	16879162
POU1F1	Activation	16879162;7529501
POU1F1	Unknown	11081207;11874696;17240357;17933456;19808898;7877625;9207961;9822660
PREB	Unknown	20411477
VDR	Unknown	10406465

Show/Hide all(25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001937	Process	Negative regulation of endothelial cell proliferation	IDA	23619365
GO:0005148	Function	Prolactin receptor binding	IBA
GO:0005148	Function	Prolactin receptor binding	TAS	10854700
GO:0005179	Function	Hormone activity	IBA
GO:0005179	Function	Hormone activity	IEA
GO:0005515	Function	Protein binding	IPI	22325776, 23048206, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	10854700
GO:0007565	Process	Female pregnancy	IBA
GO:0007565	Process	Female pregnancy	NAS	7221563
GO:0007595	Process	Lactation	IEA
GO:0016525	Process	Negative regulation of angiogenesis	NAS	23619365
GO:0030879	Process	Mammary gland development	IBA
GO:0031667	Process	Response to nutrient levels	IBA
GO:0031904	Component	Endosome lumen	TAS
GO:0031982	Component	Vesicle	IEA
GO:0038161	Process	Prolactin signaling pathway	IDA	23619365
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	23619365
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IBA
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IDA	12552091
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	23619365
GO:1903489	Process	Positive regulation of lactation	IBA

MIM	HGNC	e!Ensembl
176760	9445	ENSG00000172179

Protein

UniProt ID

P01236

Protein name

Prolactin (PRL)

Protein function

Prolactin acts primarily on the mammary gland by promoting lactation.

PDB

1RW5 , 2Q98 , 3D48 , 3EW3 , 3MZG , 3N06 , 3N0P , 3NCB , 3NCC , 3NCE , 3NCF , 3NPZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00103	Hormone_1	15 → 227	Somatotropin hormone family	Domain

Sequence

MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNL
SSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWN
EPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSG
LPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

Sequence length

227

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Neuroactive ligand-receptor interaction Hormone signaling PI3K-Akt signaling pathway JAK-STAT signaling pathway Prolactin signaling pathway		Prolactin receptor signaling Amyloid fiber formation Growth hormone receptor signaling

PRL (prolactin)