Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5610
Gene name	Eukaryotic translation initiation factor 2 alpha kinase 2
Gene symbol	EIF2AK2
Synonyms (NCBI Gene)	DYT33EIF2AK1LEUDENPKRPPP1R83PRKR
Chromosome	2
Chromosome location	2p22.2
Summary	The protein encoded by this gene is a serine/threonine protein kinase that is activated by autophosphorylation after binding to dsRNA. The activated form of the encoded protein can phosphorylate translation initiation factor EIF2S1, which in turn inhibits

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1573010519	C>T	Likely-pathogenic	Coding sequence variant, missense variant

265

Show/Hide all (265)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019974	hsa-miR-375	qRT-PCR;Microarray	20584986
MIRT022755	hsa-miR-124-3p	Proteomics	18668037
MIRT046386	hsa-miR-15b-5p	CLASH	23622248
MIRT037216	hsa-miR-877-5p	CLASH	23622248
MIRT706575	hsa-miR-495-5p	HITS-CLIP	22927820
MIRT706574	hsa-miR-34b-3p	HITS-CLIP	22927820
MIRT706573	hsa-miR-510-5p	HITS-CLIP	22927820
MIRT706572	hsa-miR-4695-5p	HITS-CLIP	22927820
MIRT706571	hsa-miR-6808-5p	HITS-CLIP	22927820
MIRT706570	hsa-miR-6893-5p	HITS-CLIP	22927820
MIRT706569	hsa-miR-940	HITS-CLIP	22927820
MIRT706568	hsa-miR-3929	HITS-CLIP	22927820
MIRT706567	hsa-miR-4419b	HITS-CLIP	22927820
MIRT706566	hsa-miR-4478	HITS-CLIP	22927820
MIRT706565	hsa-miR-3614-5p	HITS-CLIP	22927820
MIRT706564	hsa-miR-6500-3p	HITS-CLIP	22927820
MIRT706563	hsa-miR-4768-3p	HITS-CLIP	22927820
MIRT706562	hsa-miR-4459	HITS-CLIP	22927820
MIRT706561	hsa-miR-4433a-3p	HITS-CLIP	22927820
MIRT706560	hsa-miR-3664-3p	HITS-CLIP	22927820
MIRT706559	hsa-miR-4649-3p	HITS-CLIP	22927820
MIRT706558	hsa-miR-485-5p	HITS-CLIP	22927820
MIRT706557	hsa-miR-6884-5p	HITS-CLIP	22927820
MIRT706556	hsa-miR-298	HITS-CLIP	22927820
MIRT706555	hsa-miR-4722-5p	HITS-CLIP	22927820
MIRT706554	hsa-miR-7160-5p	HITS-CLIP	22927820
MIRT706553	hsa-miR-665	HITS-CLIP	22927820
MIRT668600	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT668599	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT668598	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT668597	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT668596	hsa-miR-7158-5p	HITS-CLIP	23824327
MIRT668595	hsa-miR-202-5p	HITS-CLIP	23824327
MIRT395635	hsa-miR-4769-3p	HITS-CLIP	23824327
MIRT668594	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT668593	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT668592	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT668591	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT668591	hsa-miR-4652-3p	HITS-CLIP	27418678
MIRT668591	hsa-miR-4652-3p	HITS-CLIP	27418678
MIRT668591	hsa-miR-4652-3p	HITS-CLIP	27418678
MIRT668591	hsa-miR-4652-3p	HITS-CLIP	27418678
MIRT668591	hsa-miR-4652-3p	HITS-CLIP	27418678
MIRT668592	hsa-miR-4743-3p	HITS-CLIP	27418678
MIRT668592	hsa-miR-4743-3p	HITS-CLIP	27418678
MIRT668592	hsa-miR-4743-3p	HITS-CLIP	27418678
MIRT668592	hsa-miR-4743-3p	HITS-CLIP	27418678
MIRT668592	hsa-miR-4743-3p	HITS-CLIP	27418678
MIRT668594	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT668594	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT668594	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT668594	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT668594	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT668593	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT668593	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT668593	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT668593	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT668593	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT706575	hsa-miR-495-5p	HITS-CLIP	22927820
MIRT706574	hsa-miR-34b-3p	HITS-CLIP	22927820
MIRT706573	hsa-miR-510-5p	HITS-CLIP	22927820
MIRT706572	hsa-miR-4695-5p	HITS-CLIP	22927820
MIRT706571	hsa-miR-6808-5p	HITS-CLIP	22927820
MIRT706570	hsa-miR-6893-5p	HITS-CLIP	22927820
MIRT706569	hsa-miR-940	HITS-CLIP	22927820
MIRT706568	hsa-miR-3929	HITS-CLIP	22927820
MIRT706567	hsa-miR-4419b	HITS-CLIP	22927820
MIRT706566	hsa-miR-4478	HITS-CLIP	22927820
MIRT706565	hsa-miR-3614-5p	HITS-CLIP	22927820
MIRT706564	hsa-miR-6500-3p	HITS-CLIP	22927820
MIRT706563	hsa-miR-4768-3p	HITS-CLIP	22927820
MIRT706562	hsa-miR-4459	HITS-CLIP	22927820
MIRT706561	hsa-miR-4433a-3p	HITS-CLIP	22927820
MIRT706560	hsa-miR-3664-3p	HITS-CLIP	22927820
MIRT706559	hsa-miR-4649-3p	HITS-CLIP	22927820
MIRT706558	hsa-miR-485-5p	HITS-CLIP	22927820
MIRT706557	hsa-miR-6884-5p	HITS-CLIP	22927820
MIRT706556	hsa-miR-298	HITS-CLIP	22927820
MIRT706555	hsa-miR-4722-5p	HITS-CLIP	22927820
MIRT706554	hsa-miR-7160-5p	HITS-CLIP	22927820
MIRT706553	hsa-miR-665	HITS-CLIP	22927820
MIRT668600	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT668599	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT668598	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT668597	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT668596	hsa-miR-7158-5p	HITS-CLIP	23824327
MIRT668595	hsa-miR-202-5p	HITS-CLIP	23824327
MIRT395635	hsa-miR-4769-3p	HITS-CLIP	23824327
MIRT668594	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT668593	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT668592	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT668591	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT956547	hsa-miR-1827	CLIP-seq
MIRT956548	hsa-miR-3122	CLIP-seq
MIRT956549	hsa-miR-3165	CLIP-seq
MIRT956550	hsa-miR-3665	CLIP-seq
MIRT956551	hsa-miR-3689a-3p	CLIP-seq
MIRT956552	hsa-miR-3689c	CLIP-seq
MIRT956553	hsa-miR-3913-5p	CLIP-seq
MIRT956554	hsa-miR-4433	CLIP-seq
MIRT956555	hsa-miR-4728-5p	CLIP-seq
MIRT956556	hsa-miR-4736	CLIP-seq
MIRT956557	hsa-miR-1207-3p	CLIP-seq
MIRT956558	hsa-miR-1262	CLIP-seq
MIRT956559	hsa-miR-1293	CLIP-seq
MIRT956560	hsa-miR-1294	CLIP-seq
MIRT956547	hsa-miR-1827	CLIP-seq
MIRT956561	hsa-miR-3074-3p	CLIP-seq
MIRT956562	hsa-miR-3120-5p	CLIP-seq
MIRT956563	hsa-miR-361-5p	CLIP-seq
MIRT956564	hsa-miR-3664-5p	CLIP-seq
MIRT956565	hsa-miR-3919	CLIP-seq
MIRT956566	hsa-miR-3925-3p	CLIP-seq
MIRT956567	hsa-miR-3925-5p	CLIP-seq
MIRT956568	hsa-miR-4259	CLIP-seq
MIRT956569	hsa-miR-4267	CLIP-seq
MIRT956570	hsa-miR-4316	CLIP-seq
MIRT956554	hsa-miR-4433	CLIP-seq
MIRT956571	hsa-miR-448	CLIP-seq
MIRT956572	hsa-miR-4483	CLIP-seq
MIRT956573	hsa-miR-4501	CLIP-seq
MIRT956574	hsa-miR-4522	CLIP-seq
MIRT956575	hsa-miR-4701-3p	CLIP-seq
MIRT956576	hsa-miR-4715-5p	CLIP-seq
MIRT956577	hsa-miR-510	CLIP-seq
MIRT956578	hsa-miR-511	CLIP-seq
MIRT956579	hsa-miR-512-5p	CLIP-seq
MIRT956580	hsa-miR-515-5p	CLIP-seq
MIRT956581	hsa-miR-766	CLIP-seq
MIRT1920405	hsa-miR-4773	CLIP-seq
MIRT1920406	hsa-miR-587	CLIP-seq
MIRT1920407	hsa-miR-876-3p	CLIP-seq
MIRT1983267	hsa-miR-1285	CLIP-seq
MIRT956560	hsa-miR-1294	CLIP-seq
MIRT1983268	hsa-miR-129-5p	CLIP-seq
MIRT1983269	hsa-miR-143	CLIP-seq
MIRT956547	hsa-miR-1827	CLIP-seq
MIRT1983270	hsa-miR-24	CLIP-seq
MIRT1983271	hsa-miR-2467-5p	CLIP-seq
MIRT1983272	hsa-miR-25	CLIP-seq
MIRT956549	hsa-miR-3165	CLIP-seq
MIRT1983273	hsa-miR-3178	CLIP-seq
MIRT1983274	hsa-miR-3187-5p	CLIP-seq
MIRT1983275	hsa-miR-3188	CLIP-seq
MIRT1983276	hsa-miR-32	CLIP-seq
MIRT1983277	hsa-miR-34b	CLIP-seq
MIRT1983278	hsa-miR-363	CLIP-seq
MIRT1983279	hsa-miR-367	CLIP-seq
MIRT956565	hsa-miR-3919	CLIP-seq
MIRT956567	hsa-miR-3925-5p	CLIP-seq
MIRT1983280	hsa-miR-3975	CLIP-seq
MIRT956569	hsa-miR-4267	CLIP-seq
MIRT1983281	hsa-miR-4284	CLIP-seq
MIRT956570	hsa-miR-4316	CLIP-seq
MIRT1983282	hsa-miR-4317	CLIP-seq
MIRT1983283	hsa-miR-4325	CLIP-seq
MIRT956554	hsa-miR-4433	CLIP-seq
MIRT1983284	hsa-miR-4486	CLIP-seq
MIRT956573	hsa-miR-4501	CLIP-seq
MIRT1983285	hsa-miR-4505	CLIP-seq
MIRT1983286	hsa-miR-4770	CLIP-seq
MIRT1983287	hsa-miR-508-5p	CLIP-seq
MIRT956577	hsa-miR-510	CLIP-seq
MIRT956579	hsa-miR-512-5p	CLIP-seq
MIRT1983288	hsa-miR-592	CLIP-seq
MIRT1983289	hsa-miR-597	CLIP-seq
MIRT1983290	hsa-miR-600	CLIP-seq
MIRT1983291	hsa-miR-612	CLIP-seq
MIRT1983292	hsa-miR-616	CLIP-seq
MIRT1983293	hsa-miR-661	CLIP-seq
MIRT956581	hsa-miR-766	CLIP-seq
MIRT1983294	hsa-miR-892a	CLIP-seq
MIRT1983295	hsa-miR-92a	CLIP-seq
MIRT1983296	hsa-miR-92b	CLIP-seq
MIRT1983267	hsa-miR-1285	CLIP-seq
MIRT956560	hsa-miR-1294	CLIP-seq
MIRT1983269	hsa-miR-143	CLIP-seq
MIRT956547	hsa-miR-1827	CLIP-seq
MIRT1983271	hsa-miR-2467-5p	CLIP-seq
MIRT1983272	hsa-miR-25	CLIP-seq
MIRT1983273	hsa-miR-3178	CLIP-seq
MIRT1983274	hsa-miR-3187-5p	CLIP-seq
MIRT1983275	hsa-miR-3188	CLIP-seq
MIRT1983276	hsa-miR-32	CLIP-seq
MIRT1983277	hsa-miR-34b	CLIP-seq
MIRT1983278	hsa-miR-363	CLIP-seq
MIRT1983279	hsa-miR-367	CLIP-seq
MIRT956565	hsa-miR-3919	CLIP-seq
MIRT956567	hsa-miR-3925-5p	CLIP-seq
MIRT1983280	hsa-miR-3975	CLIP-seq
MIRT956569	hsa-miR-4267	CLIP-seq
MIRT956570	hsa-miR-4316	CLIP-seq
MIRT1983282	hsa-miR-4317	CLIP-seq
MIRT1983283	hsa-miR-4325	CLIP-seq
MIRT956554	hsa-miR-4433	CLIP-seq
MIRT1983284	hsa-miR-4486	CLIP-seq
MIRT956573	hsa-miR-4501	CLIP-seq
MIRT1983285	hsa-miR-4505	CLIP-seq
MIRT1983286	hsa-miR-4770	CLIP-seq
MIRT1983287	hsa-miR-508-5p	CLIP-seq
MIRT956577	hsa-miR-510	CLIP-seq
MIRT956579	hsa-miR-512-5p	CLIP-seq
MIRT1983288	hsa-miR-592	CLIP-seq
MIRT1983289	hsa-miR-597	CLIP-seq
MIRT1983291	hsa-miR-612	CLIP-seq
MIRT1983292	hsa-miR-616	CLIP-seq
MIRT1983293	hsa-miR-661	CLIP-seq
MIRT956581	hsa-miR-766	CLIP-seq
MIRT1983294	hsa-miR-892a	CLIP-seq
MIRT1983295	hsa-miR-92a	CLIP-seq
MIRT1983296	hsa-miR-92b	CLIP-seq
MIRT1983267	hsa-miR-1285	CLIP-seq
MIRT956547	hsa-miR-1827	CLIP-seq
MIRT1983272	hsa-miR-25	CLIP-seq
MIRT956562	hsa-miR-3120-5p	CLIP-seq
MIRT1983274	hsa-miR-3187-5p	CLIP-seq
MIRT1983276	hsa-miR-32	CLIP-seq
MIRT1983278	hsa-miR-363	CLIP-seq
MIRT956564	hsa-miR-3664-5p	CLIP-seq
MIRT1983279	hsa-miR-367	CLIP-seq
MIRT1983282	hsa-miR-4317	CLIP-seq
MIRT1983283	hsa-miR-4325	CLIP-seq
MIRT956554	hsa-miR-4433	CLIP-seq
MIRT956574	hsa-miR-4522	CLIP-seq
MIRT1983287	hsa-miR-508-5p	CLIP-seq
MIRT956578	hsa-miR-511	CLIP-seq
MIRT1983291	hsa-miR-612	CLIP-seq
MIRT1983292	hsa-miR-616	CLIP-seq
MIRT1983293	hsa-miR-661	CLIP-seq
MIRT956581	hsa-miR-766	CLIP-seq
MIRT1983295	hsa-miR-92a	CLIP-seq
MIRT1983296	hsa-miR-92b	CLIP-seq
MIRT1983267	hsa-miR-1285	CLIP-seq
MIRT956547	hsa-miR-1827	CLIP-seq
MIRT1983272	hsa-miR-25	CLIP-seq
MIRT956562	hsa-miR-3120-5p	CLIP-seq
MIRT956548	hsa-miR-3122	CLIP-seq
MIRT956549	hsa-miR-3165	CLIP-seq
MIRT1983274	hsa-miR-3187-5p	CLIP-seq
MIRT1983276	hsa-miR-32	CLIP-seq
MIRT2679870	hsa-miR-339-5p	CLIP-seq
MIRT1983278	hsa-miR-363	CLIP-seq
MIRT956564	hsa-miR-3664-5p	CLIP-seq
MIRT956550	hsa-miR-3665	CLIP-seq
MIRT1983279	hsa-miR-367	CLIP-seq
MIRT956551	hsa-miR-3689a-3p	CLIP-seq
MIRT956552	hsa-miR-3689c	CLIP-seq
MIRT956553	hsa-miR-3913-5p	CLIP-seq
MIRT956569	hsa-miR-4267	CLIP-seq
MIRT1983282	hsa-miR-4317	CLIP-seq
MIRT1983283	hsa-miR-4325	CLIP-seq
MIRT956554	hsa-miR-4433	CLIP-seq
MIRT956574	hsa-miR-4522	CLIP-seq
MIRT956555	hsa-miR-4728-5p	CLIP-seq
MIRT956556	hsa-miR-4736	CLIP-seq
MIRT1983287	hsa-miR-508-5p	CLIP-seq
MIRT956577	hsa-miR-510	CLIP-seq
MIRT956578	hsa-miR-511	CLIP-seq
MIRT956579	hsa-miR-512-5p	CLIP-seq
MIRT1983291	hsa-miR-612	CLIP-seq
MIRT1983292	hsa-miR-616	CLIP-seq
MIRT1983293	hsa-miR-661	CLIP-seq
MIRT956581	hsa-miR-766	CLIP-seq
MIRT1983295	hsa-miR-92a	CLIP-seq
MIRT1983296	hsa-miR-92b	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
IRF1	Activation	8622878

Show/Hide all (80)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0001819	Process	Positive regulation of cytokine production	ISS
GO:0002376	Process	Immune system process	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003723	Function	RNA binding	IEA
GO:0003725	Function	Double-stranded RNA binding	IDA	21266579
GO:0003725	Function	Double-stranded RNA binding	IEA
GO:0003725	Function	Double-stranded RNA binding	TAS	1351683
GO:0004672	Function	Protein kinase activity	IDA	12882984, 15229216, 18835251, 22948139
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	IMP	21123651
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	1695551
GO:0004694	Function	Eukaryotic translation initiation factor 2alpha kinase activity	IBA
GO:0004694	Function	Eukaryotic translation initiation factor 2alpha kinase activity	IMP	25329545
GO:0004694	Function	Eukaryotic translation initiation factor 2alpha kinase activity	TAS	10866685
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	8576172, 9143277, 9431994, 10390359, 10488152, 11160738, 11773402, 11836380, 12610133, 12882984, 15121867, 15229216, 16288713, 16785445, 16957780, 18096616, 18362360, 18835251, 18971339, 20395957, 21903422, 22801494, 23455922, 32296183, 32707033, 33961781, 34035218, 34578187, 347800
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	21123651
GO:0005737	Component	Cytoplasm	IDA	15121867
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005840	Component	Ribosome	TAS	10390359
GO:0006412	Process	Translation	IEA
GO:0006413	Process	Translational initiation	IDA	10563826, 12133843
GO:0006446	Process	Regulation of translational initiation	IBA
GO:0006468	Process	Protein phosphorylation	IDA	19189853
GO:0006468	Process	Protein phosphorylation	TAS	1695551
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	1351683
GO:0009615	Process	Response to virus	IMP	19189853
GO:0016020	Component	Membrane	HDA	19946888
GO:0016301	Function	Kinase activity	IDA	21123651
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0017148	Process	Negative regulation of translation	IBA
GO:0017148	Process	Negative regulation of translation	IDA	12882984
GO:0017148	Process	Negative regulation of translation	IMP	12610133, 19189853
GO:0019888	Function	Protein phosphatase regulator activity	TAS	10866685
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IEA
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032722	Process	Positive regulation of chemokine production	ISS
GO:0032874	Process	Positive regulation of stress-activated MAPK cascade	IEA
GO:0032874	Process	Positive regulation of stress-activated MAPK cascade	ISS
GO:0033689	Process	Negative regulation of osteoblast proliferation	IMP	16216244
GO:0034198	Process	Cellular response to amino acid starvation	IEA
GO:0034198	Process	Cellular response to amino acid starvation	IMP	25329545
GO:0035455	Process	Response to interferon-alpha	IDA	19840259
GO:0042802	Function	Identical protein binding	IPI	16373505
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IMP	15229216
GO:0045071	Process	Negative regulation of viral genome replication	IEA
GO:0045071	Process	Negative regulation of viral genome replication	IMP	19189853, 19840259
GO:0045087	Process	Innate immune response	IEA
GO:0046777	Process	Protein autophosphorylation	IDA	22801494
GO:0046777	Process	Protein autophosphorylation	IMP	16216244
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	15121867
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	15121867
GO:0051607	Process	Defense response to virus	IEA
GO:0051607	Process	Defense response to virus	IEP	32634389
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0140374	Process	Antiviral innate immune response	IDA	22948139
GO:1900225	Process	Regulation of NLRP3 inflammasome complex assembly	IEA
GO:1900225	Process	Regulation of NLRP3 inflammasome complex assembly	ISS
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IEA
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	ISS
GO:1901532	Process	Regulation of hematopoietic progenitor cell differentiation	IEA
GO:1901532	Process	Regulation of hematopoietic progenitor cell differentiation	ISS
GO:1902033	Process	Regulation of hematopoietic stem cell proliferation	IEA
GO:1902033	Process	Regulation of hematopoietic stem cell proliferation	ISS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	IEA
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	ISS

MIM	HGNC	e!Ensembl
176871	9437	ENSG00000055332

P19525

Protein name

Interferon-induced, double-stranded RNA-activated protein kinase (EC 2.7.11.1) (Eukaryotic translation initiation factor 2-alpha kinase 2) (eIF-2A protein kinase 2) (Interferon-inducible RNA-dependent protein kinase) (P1/eIF-2A protein kinase) (Protein ki

Protein function

IFN-induced dsRNA-dependent serine/threonine-protein kinase that phosphorylates the alpha subunit of eukaryotic translation initiation factor 2 (EIF2S1/eIF-2-alpha) and plays a key role in the innate immune response to viral infection (PubMed:18

PDB

1QU6 , 2A19 , 2A1A , 3UIU , 6D3K , 6D3L , 7OBK , 7OBL , 8BI7 , 8I9J , 8IZN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00035	dsrm	10 → 75	Double-stranded RNA binding motif	Domain
PF00035	dsrm	101 → 165	Double-stranded RNA binding motif	Domain
PF00069	Pkinase	267 → 537	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in thymus, spleen and bone marrow compared to non-hematopoietic tissues such as small intestine, liver, or kidney tissues. Colocalizes with GSK3B and TAU in the Alzheimer disease (AD) brain. Elevated levels seen in bre

Sequence

MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSK
KEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQ
CASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSG
SFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAK
RSLAPRFDLPDMKETKYTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY
NNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTK
CLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNI
FLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAE
LLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWK
KSPEKNERHTC

Sequence length

551

Interactions

View interactions

	KEGG		Reactome
	Necroptosis Alzheimer disease Hepatitis C Measles Influenza A Human papillomavirus infection Kaposi sarcoma-associated herpesvirus infection Herpes simplex virus 1 infection Epstein-Barr virus infection Coronavirus disease - COVID-19 Viral carcinogenesis		ISG15 antiviral mechanism Inhibition of PKR

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Dystonia 33	Likely pathogenic; Pathogenic	rs2148705154	RCV001807542 RCV001807544
Leukoencephalopathy, developmental delay, and episodic neurologic regression syndrome	Likely pathogenic	rs2148703089	RCV001527613

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cognitive impairment	Conflicting classifications of pathogenicity	rs1573010519	RCV001009329
Colon adenocarcinoma	Likely benign	rs377410593	RCV005870085
Developmental regression	Uncertain significance; Conflicting classifications of pathogenicity	rs1573031858, rs1573031939, rs1572996700	RCV001004044 RCV001004045 RCV001009605
EIF2AK2-related disorder	Uncertain significance	rs1363544084, rs2466922428, rs2466895698, rs1573029592	RCV003408742 RCV003402934 RCV003983322 RCV000991217 RCV000991207
Gastric cancer	Likely benign	rs772883798	RCV005928465
Global developmental delay	Uncertain significance; Conflicting classifications of pathogenicity	rs1573031858, rs1573031939, rs1572996700	RCV001004044 RCV001004045 RCV001009605
Hepatocellular carcinoma	Likely benign	rs377410593	RCV005870086
Leukoencephalopathy	Uncertain significance; Conflicting classifications of pathogenicity	rs1573031858, rs1573031939, rs1572996700	RCV001004044 RCV001004045 RCV001009605
Nonpapillary renal cell carcinoma	Likely benign	rs377410593	RCV005870087
Uterine corpus endometrial carcinoma	Likely benign	rs377410593	RCV005870088

Show/Hide Text Mining Associations (106)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acquired Immunodeficiency Syndrome	Associate	25653431
Adenocarcinoma	Associate	25798539
Alzheimer Disease	Associate	19210572, 20067632
Anorchia	Associate	32197074
Arthritis Reactive	Associate	23349666
Asthma	Associate	26399222
Ataxia	Associate	32197074
Autoimmune Diseases	Associate	19337998, 31031002
Bone Marrow Failure Disorders	Associate	21659535
Breast Neoplasms	Associate	18490711, 18559534, 23029376, 23112838
Burkitt Lymphoma	Associate	11867523
Carcinogenesis	Inhibit	12882984
Carcinogenesis	Associate	18446370, 21518807, 22926522, 33749640
Carcinogenesis	Stimulate	23029376
Carcinoma Hepatocellular	Associate	19259124, 22894766, 23844083, 30794626, 32106574
Carcinoma Non Small Cell Lung	Inhibit	20930042
Carcinoma Non Small Cell Lung	Associate	22102852, 23370317, 33562773
Carcinoma Squamous Cell	Stimulate	23029376
Chemical and Drug Induced Liver Injury	Associate	30794626, 32106574
Cholangiocarcinoma	Associate	22926522
Cognition Disorders	Associate	19210572, 32197074
Colorectal Neoplasms	Associate	28300830, 33749640
Coronavirus Infections	Inhibit	33811184
COVID 19	Stimulate	33811184, 37979658
COVID 19	Associate	34058265, 35623072
Cytokine Release Syndrome	Associate	31951974
Developmental Disabilities	Associate	32197074
Diabetes Mellitus Type 2	Associate	27106634
Drug Hypersensitivity	Associate	15299030
Drug Related Side Effects and Adverse Reactions	Associate	23029376
Dysarthria	Associate	32197074
Dyskinesias	Associate	32197074
Dystonia	Associate	26231208, 33049316, 33236446
Enterovirus Infections	Associate	31941779
Epstein Barr Virus Infections	Associate	11068051, 23254370
Esophageal Squamous Cell Carcinoma	Associate	35436983
Fanconi Anemia	Associate	12882984, 15299030
Fatigue Syndrome Chronic	Stimulate	9437407
Fatty Liver Alcoholic	Associate	30794626
Fever	Associate	32197074
Fibrosarcoma	Associate	22271759
Fibrosis	Associate	32106574
Genetic Diseases Inborn	Associate	38279321
Glioma	Associate	35406793
Graves Disease	Associate	33367784
Heart Failure	Associate	32197074
Hepatitis C	Stimulate	18336742
Hepatitis C	Associate	23844083, 24486950, 33248325
Hepatitis C Chronic	Associate	32106574
Hepatitis Chronic	Associate	22894766
HIV Infections	Associate	19605474, 25653431, 28186978
HTLV I Infections	Associate	10491127, 8764027, 8995707
HTLV I Infections	Inhibit	10516008
Hyperplasia	Stimulate	23029376
Infections	Associate	16188979, 24089560, 32197074, 38376197
Inflammation	Associate	18653246, 21338484, 27106634, 28869834, 29170442, 30846715, 38279321
Inflammation	Stimulate	25004084
Insulin Resistance	Associate	23519983
Intellectual Disability	Associate	32197074, 33236446
Language Disorders	Associate	32197074
Leukemia T Cell	Associate	11278390
Leukodystrophy Metachromatic	Associate	32197074
Leukoencephalopathies	Associate	32197074
Liver Cirrhosis	Inhibit	17526009
Liver Cirrhosis	Associate	32106574
Lung Neoplasms	Associate	20930042, 22102852, 25798539, 27203671, 33562773
Lupus Erythematosus Systemic	Associate	11120763, 27257790, 35757721
Lupus Erythematosus Systemic	Stimulate	31031002
Lymphatic Metastasis	Inhibit	20930042
Lymphatic Metastasis	Stimulate	23029376
Lymphocytic Choriomeningitis	Inhibit	38376197
Lymphoma Non Hodgkin	Associate	16123598
Melanoma	Associate	21338484, 24850177
Mouth Neoplasms	Associate	34384424, 35421271
Multiple Myeloma	Associate	35677537
Muscle Hypertonia	Associate	32197074
Muscle Hypotonia	Associate	32197074
Muscle Spasticity	Associate	33236446
Muscular Atrophy	Associate	18087277
Myelodysplastic Syndromes	Associate	21659535
Myotonic Dystrophy	Associate	20479119, 33856033
Nasopharyngeal Carcinoma	Associate	36683218
Neoplasm Metastasis	Associate	36683218
Neoplasms	Associate	12882984, 16123598, 18087277, 19106640, 19210572, 21338484, 22064321, 22102852, 22926522, 23112838, 23784735, 26269597, 28703114, 29022489, 30575730, 31951974, 9422082 View all (2 more)
Neoplasms	Inhibit	22894766, 33562773, 33749640, 7568028
Neurodegenerative Diseases	Associate	29170442
Neurologic Manifestations	Associate	15063753
Obesity	Associate	23519983
Oncogene Addiction	Stimulate	25004084
Osteoarthritis	Stimulate	28869834
Osteosarcoma	Associate	17014383, 23527187
Parkinson Disease	Associate	15299030, 37107677
Persistent Infection	Associate	30738360
Personality Disorders	Inhibit	20930042
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	18957415
Psoriasis	Associate	17928888
Respiratory Sounds	Associate	26399222
Retinal Dysplasia	Stimulate	23029376
Skin Diseases	Associate	17928888
Sleep Deprivation	Associate	15516717
Squamous Cell Carcinoma of Head and Neck	Associate	9422082
Thyroid Neoplasms	Associate	27612419
Vanishing White Matter Leukodystrophy with Ovarian Failure	Associate	32197074
Virus Diseases	Associate	15711931, 19229320, 22926522, 25856684, 28702377, 33049316
Virus Diseases	Stimulate	19605474, 30265185
Weight Loss	Stimulate	18087277

EIF2AK2 (eukaryotic translation initiation factor 2 alpha kinase 2)