Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5608
Gene name Gene Name - the full gene name approved by the HGNC.	Mitogen-activated protein kinase kinase 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MAP2K6
Synonyms (NCBI Gene) Gene synonyms aliases	CRCMSL, MAPKK6, MEK6, MKK6, PRKMK6, SAPKK-3, SAPKK3
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q24.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the dual specificity protein kinase family, which functions as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multipl

Show/Hide all(56)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016670	hsa-miR-425-5p	Sequencing	20371350
MIRT021513	hsa-miR-145-5p	Reporter assay;Microarray	21351259
MIRT053745	hsa-miR-29b-3p	Microarray	22942087
MIRT720403	hsa-miR-6769a-3p	HITS-CLIP	19536157
MIRT720402	hsa-miR-5587-5p	HITS-CLIP	19536157
MIRT573371	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT573370	hsa-miR-1324	PAR-CLIP	20371350
MIRT573369	hsa-miR-922	PAR-CLIP	20371350
MIRT573368	hsa-miR-6804-5p	PAR-CLIP	20371350
MIRT573367	hsa-miR-3166	PAR-CLIP	20371350
MIRT573366	hsa-miR-6834-5p	PAR-CLIP	20371350
MIRT573365	hsa-miR-1226-5p	PAR-CLIP	20371350
MIRT573364	hsa-miR-6734-5p	PAR-CLIP	20371350
MIRT573363	hsa-miR-1304-5p	PAR-CLIP	20371350
MIRT573362	hsa-miR-8055	PAR-CLIP	20371350
MIRT473850	hsa-miR-590-3p	PAR-CLIP	23592263
MIRT473845	hsa-miR-411-5p	PAR-CLIP	23592263
MIRT473849	hsa-miR-6872-3p	PAR-CLIP	23592263
MIRT473847	hsa-miR-4735-5p	PAR-CLIP	23592263
MIRT473848	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT473846	hsa-miR-4775	PAR-CLIP	23592263
MIRT473845	hsa-miR-411-5p	PAR-CLIP	23592263
MIRT473844	hsa-miR-3149	PAR-CLIP	23592263
MIRT732300	hsa-miR-625-3p	Luciferase reporter assay, qRT-PCR, Western blot	27526785
MIRT732300	hsa-miR-625-3p	Luciferase reporter assay, qRT-PCR, Western blot	27526785
MIRT732300	hsa-miR-625-3p	Luciferase reporter assay, qRT-PCR, Western blot	27526785
MIRT735799	hsa-miR-10a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	33128541
MIRT720403	hsa-miR-6769a-3p	HITS-CLIP	19536157
MIRT720402	hsa-miR-5587-5p	HITS-CLIP	19536157
MIRT573371	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT573370	hsa-miR-1324	PAR-CLIP	20371350
MIRT573369	hsa-miR-922	PAR-CLIP	20371350
MIRT573368	hsa-miR-6804-5p	PAR-CLIP	20371350
MIRT573367	hsa-miR-3166	PAR-CLIP	20371350
MIRT573366	hsa-miR-6834-5p	PAR-CLIP	20371350
MIRT573365	hsa-miR-1226-5p	PAR-CLIP	20371350
MIRT573364	hsa-miR-6734-5p	PAR-CLIP	20371350
MIRT573363	hsa-miR-1304-5p	PAR-CLIP	20371350
MIRT573362	hsa-miR-8055	PAR-CLIP	20371350
MIRT473850	hsa-miR-590-3p	PAR-CLIP	23592263
MIRT473845	hsa-miR-411-5p	PAR-CLIP	23592263
MIRT473849	hsa-miR-6872-3p	PAR-CLIP	23592263
MIRT473847	hsa-miR-4735-5p	PAR-CLIP	23592263
MIRT473848	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT473846	hsa-miR-4775	PAR-CLIP	23592263
MIRT473845	hsa-miR-411-5p	PAR-CLIP	23592263
MIRT473844	hsa-miR-3149	PAR-CLIP	23592263
MIRT755867	hsa-miR-643	Luciferase reporter assay, Western blotting, qRT-PCR, In situ hybridization, RNA pull down assay	34581623
MIRT1920611	hsa-miR-34c-3p	CLIP-seq
MIRT1920612	hsa-miR-374a	CLIP-seq
MIRT1920613	hsa-miR-374b	CLIP-seq
MIRT1920611	hsa-miR-34c-3p	CLIP-seq
MIRT1920612	hsa-miR-374a	CLIP-seq
MIRT1920613	hsa-miR-374b	CLIP-seq
MIRT2266661	hsa-miR-4305	CLIP-seq
MIRT2266662	hsa-miR-664	CLIP-seq

Show/Hide all(32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0000187	Process	Activation of MAPK activity	IBA	21873635
GO:0000187	Process	Activation of MAPK activity	IDA	8663524, 9218798
GO:0000187	Process	Activation of MAPK activity	TAS
GO:0002931	Process	Response to ischemia	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004708	Function	MAP kinase kinase activity	IBA	21873635
GO:0004708	Function	MAP kinase kinase activity	IDA	8663524, 9218798
GO:0004708	Function	MAP kinase kinase activity	TAS
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	11035004, 12052864, 15229216, 20067578, 25241761, 32296183, 32814053, 32911434
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006975	Process	DNA damage induced protein phosphorylation	TAS	10848581
GO:0007050	Process	Cell cycle arrest	TAS	10848581
GO:0007165	Process	Signal transduction	TAS	8621675
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IEA
GO:0019901	Function	Protein kinase binding	IPI	11279118
GO:0022602	Process	Ovulation cycle process	IEA
GO:0032308	Process	Positive regulation of prostaglandin secretion	IEA
GO:0042493	Process	Response to drug	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0051770	Process	Positive regulation of nitric-oxide synthase biosynthetic process	IEA
GO:0060048	Process	Cardiac muscle contraction	IEA
GO:0070423	Process	Nucleotide-binding oligomerization domain containing signaling pathway	TAS
GO:0072709	Process	Cellular response to sorbitol	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	29021624

MIM	HGNC	e!Ensembl
601254	6846	ENSG00000108984

Protein

UniProt ID

P52564

Protein name

Dual specificity mitogen-activated protein kinase kinase 6 (MAP kinase kinase 6) (MAPKK 6) (EC 2.7.12.2) (MAPK/ERK kinase 6) (MEK 6) (Stress-activated protein kinase kinase 3) (SAPK kinase 3) (SAPKK-3) (SAPKK3)

Protein function

Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. With MAP3K3/MKK3, catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinases p38 MAPK11,

PDB

2Y8O , 3ENM , 3FME , 3VN9 , 5ETF , 8A8M , 8P7J , 8PM3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	53 → 314	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 2 is only expressed in skeletal muscle. Isoform 1 is expressed in skeletal muscle, heart, and in lesser extent in liver or pancreas. {ECO:0000269|PubMed:8621675}.

Sequence

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Sequence length

334

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Rap1 signaling pathway Cellular senescence Osteoclast differentiation Toll-like receptor signaling pathway Fc epsilon RI signaling pathway TNF signaling pathway Inflammatory mediator regulation of TRP channels GnRH signaling pathway Growth hormone synthesis, secretion and action Alcoholic liver disease Amyotrophic lateral sclerosis Pathways of neurodegeneration - multiple diseases Salmonella infection Yersinia infection Toxoplasmosis Hepatitis B Human cytomegalovirus infection Kaposi sarcoma-associated herpesvirus infection Epstein-Barr virus infection Human immunodeficiency virus 1 infection PD-L1 expression and PD-1 checkpoint pathway in cancer Lipid and atherosclerosis Fluid shear stress and atherosclerosis		NOD1/2 Signaling Pathway Oxidative Stress Induced Senescence activated TAK1 mediates p38 MAPK activation Uptake and function of anthrax toxins PI5P Regulates TP53 Acetylation Interleukin-1 signaling

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Colonic neoplasms	Malignant tumor of colon, Colonic Neoplasms	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483	15037631

Show/Hide Text Mining Associations (25)

Disease Name	Relationship Type	References
Associations from Text Mining
Arthritis Rheumatoid	Associate	14695331, 33483588
Breast Neoplasms	Associate	16000313, 19245689, 32977823, 35441810, 35919504
Carcinoma Non Small Cell Lung	Associate	37705754
Chemical and Drug Induced Liver Injury	Associate	32418112
Colonic Neoplasms	Associate	27526785, 29402903
Colorectal Neoplasms	Associate	15037631
Dissection Thoracic Aorta	Associate	29669321
Glioma	Associate	17012236
Inflammation	Associate	14695331, 16230348, 31156213, 40629361
Intervertebral Disc Degeneration	Associate	23661466
Liposarcoma	Associate	31801397
Mitochondrial Diseases	Associate	19245689
Neoplasm Metastasis	Associate	16780590
Neoplasms	Associate	23319048, 35637967
Neoplasms Mesothelial	Associate	14656993
Obesity	Associate	19265796
Ovarian Neoplasms	Associate	28604448
Paralysis	Associate	24737428
Periodontitis	Associate	36214094
Polycystic Ovary Syndrome	Associate	33372369
Prostatic Neoplasms	Associate	20168333
Rhabdomyosarcoma Embryonal	Associate	35801577
Tachycardia Atrioventricular Nodal Reentry	Associate	16780590
Tuberculosis Spinal	Associate	40629361
Urinary Bladder Neoplasms	Associate	16780590

MAP2K6 (mitogen-activated protein kinase kinase 6)