Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5607
Gene name Gene Name - the full gene name approved by the HGNC.	Mitogen-activated protein kinase kinase 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MAP2K5
Synonyms (NCBI Gene) Gene synonyms aliases	HsT17454, MAPKK5, MEK5, PRKMK5
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q23
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically interacts with and activates MAPK7/ERK5. This kinase itself can be phosphorylated and activated by MAP3K3/MEKK3, a

Show/Hide all(4)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018716	hsa-miR-335-5p	Microarray	18185580
MIRT024959	hsa-miR-214-3p	Microarray;Other	19859982
MIRT438086	hsa-miR-330-3p	Genotyping	24436253
MIRT438086	hsa-miR-330-3p	Genotyping	24436253

Show/Hide all(50)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000165	Process	MAPK cascade	IBA
GO:0000165	Process	MAPK cascade	IEA
GO:0000165	Process	MAPK cascade	IEA
GO:0000165	Process	MAPK cascade	ISS	20551324
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	7759517
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004708	Function	MAP kinase kinase activity	IBA
GO:0004708	Function	MAP kinase kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	7759517, 14743216, 17474147, 18588859, 21516116, 21988832, 22939624, 25241761, 28514442, 29892012, 31515488, 31980649, 32296183, 32707033, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005819	Component	Spindle	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	7759517
GO:0007507	Process	Heart development	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0032717	Process	Negative regulation of interleukin-8 production	IEA
GO:0032717	Process	Negative regulation of interleukin-8 production	ISS	20551324
GO:0034115	Process	Negative regulation of heterotypic cell-cell adhesion	IEA
GO:0034115	Process	Negative regulation of heterotypic cell-cell adhesion	ISS	20551324
GO:0034392	Process	Negative regulation of smooth muscle cell apoptotic process	IEA
GO:0034392	Process	Negative regulation of smooth muscle cell apoptotic process	ISS
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IEA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	ISS	20551324
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0051247	Process	Positive regulation of protein metabolic process	IEA
GO:0051247	Process	Positive regulation of protein metabolic process	ISS
GO:0060761	Process	Negative regulation of response to cytokine stimulus	IEA
GO:0060761	Process	Negative regulation of response to cytokine stimulus	ISS	20551324
GO:0070375	Process	ERK5 cascade	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	ISS	20551324
GO:0071499	Process	Cellular response to laminar fluid shear stress	TAS	20551324
GO:0090051	Process	Negative regulation of cell migration involved in sprouting angiogenesis	IEA
GO:0090051	Process	Negative regulation of cell migration involved in sprouting angiogenesis	ISS	20551324
GO:0106310	Function	Protein serine kinase activity	IEA
GO:2000342	Process	Negative regulation of chemokine (C-X-C motif) ligand 2 production	IEA
GO:2000342	Process	Negative regulation of chemokine (C-X-C motif) ligand 2 production	ISS	20551324
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	ISS	20551324

MIM	HGNC	e!Ensembl
602520	6845	ENSG00000137764

Protein

UniProt ID

Q13163

Protein name

Dual specificity mitogen-activated protein kinase kinase 5 (MAP kinase kinase 5) (MAPKK 5) (EC 2.7.12.2) (MAPK/ERK kinase 5) (MEK 5)

Protein function

Acts as a scaffold for the formation of a ternary MAP3K2/MAP3K3-MAP3K5-MAPK7 signaling complex. Activation of this pathway appears to play a critical role in protecting cells from stress-induced apoptosis, neuronal survival and cardiac developme

PDB

2NPT , 2O2V , 4IC7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00564	PB1	18 → 100	PB1 domain	Domain
PF00069	Pkinase	166 → 419	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in many adult tissues. Abundant in heart and skeletal muscle.

Sequence

MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
KVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTV
YKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKMPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQ
KNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIV
QFNDGNAAVVSMWVCRALEERRSQQGPP

Sequence length

448

Interactions

View interactions

	KEGG
	MAPK signaling pathway Gap junction Neurotrophin signaling pathway Oxytocin signaling pathway Fluid shear stress and atherosclerosis

Show/Hide Unknown Diseases (7)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Colorectal Cancer	Colorectal cancer	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Heart Failure	Heart failure	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Motion Sickness	Motion sickness	N/A	N/A	GWAS
Obesity	Obesity	N/A	N/A	GWAS
Restless Legs Syndrome	Restless legs syndrome	N/A	N/A	GWAS

Show/Hide Text Mining Associations (27)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Agoraphobia	Associate	24436253
Anxiety	Associate	24436253
Anxiety Disorders	Associate	24436253
Breast Neoplasms	Associate	19087274, 35609325
Cap Myopathy	Associate	23321517
Carcinogenesis	Associate	21861603, 22458985, 27160304, 39972514
Colorectal Neoplasms	Associate	21861603, 22458985
Colorectal Neoplasms	Stimulate	27160304
COVID 19	Stimulate	35504488
Depressive Disorder	Associate	24436253
Depressive Disorder Major	Associate	24436253
Diabetes Mellitus Type 2	Associate	28812028
Drug Resistant Epilepsy	Associate	24436253
Glioblastoma	Associate	36968222
Glioma	Associate	36968222
Hypertension Pulmonary	Associate	11282888
Lymphatic Metastasis	Stimulate	27160304
Neoplasm Metastasis	Associate	19087274, 27160304
Neoplasms	Associate	16207477, 22458985, 27160304, 37919293
Nocturnal Myoclonus Syndrome	Associate	25142570, 26498236
Obesity	Associate	22513296, 22594783, 23539184, 24626232, 26449484, 26800887, 27421018, 29220676, 29666371
Osteoporosis	Associate	34142171
Osteosarcoma	Associate	39972514
Prostatic Neoplasms	Associate	15805119, 17406359, 23321517
Prostatitis	Associate	16207477, 17406359
Restless Legs Syndrome	Associate	19279021, 21572129, 21925394, 24436253, 25817513, 30111810
Tremor	Associate	25817513

MAP2K5 (mitogen-activated protein kinase kinase 5)