Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5606
Gene name Gene Name - the full gene name approved by the HGNC.	Mitogen-activated protein kinase kinase 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MAP2K3
Synonyms (NCBI Gene) Gene synonyms aliases	MAPKK3, MEK3, MKK3, PRKMK3, SAPKK-2, SAPKK2
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17p11.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphory

Show/Hide all(247)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005426	hsa-miR-214-3p	GFP reporter assay, Microarray, qRT-PCR, Western blot	19859982
MIRT005426	hsa-miR-214-3p	GFP reporter assay, Microarray, qRT-PCR, Western blot	19859982
MIRT006772	hsa-miR-20a-5p	Luciferase reporter assay	22696064
MIRT006772	hsa-miR-20a-5p	Luciferase reporter assay	22696064
MIRT006772	hsa-miR-20a-5p	Luciferase reporter assay	22696064
MIRT006772	hsa-miR-20a-5p	Luciferase reporter assay	22696064
MIRT006772	hsa-miR-20a-5p	Luciferase reporter assay	22696064
MIRT022960	hsa-miR-124-3p	Microarray	18668037
MIRT005426	hsa-miR-214-3p	Reporter assay;qRT-PCR;Microarray;Other	19859982
MIRT028553	hsa-miR-30a-5p	Proteomics	18668040
MIRT076343	hsa-miR-21-5p	Immunohistochemistry, Luciferase reporter assay, Western blot	24112539
MIRT076343	hsa-miR-21-5p	Immunohistochemistry, Luciferase reporter assay, Western blot	24112539
MIRT440289	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT144865	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT144866	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT440289	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT005426	hsa-miR-214-3p	PAR-CLIP	26701625
MIRT735289	hsa-miR-28-3p	qRT-PCR	32425976
MIRT736107	mmu-miR-21a-5p	Luciferase reporter assay, Flow cytometry	31585536
MIRT1127959	hsa-miR-103a	CLIP-seq
MIRT1127960	hsa-miR-107	CLIP-seq
MIRT1127961	hsa-miR-1193	CLIP-seq
MIRT1127962	hsa-miR-1271	CLIP-seq
MIRT1127963	hsa-miR-1285	CLIP-seq
MIRT1127964	hsa-miR-1302	CLIP-seq
MIRT1127965	hsa-miR-15a	CLIP-seq
MIRT1127966	hsa-miR-15b	CLIP-seq
MIRT1127967	hsa-miR-16	CLIP-seq
MIRT1127968	hsa-miR-182	CLIP-seq
MIRT1127969	hsa-miR-1909	CLIP-seq
MIRT1127970	hsa-miR-195	CLIP-seq
MIRT1127971	hsa-miR-3122	CLIP-seq
MIRT1127972	hsa-miR-3136-3p	CLIP-seq
MIRT1127973	hsa-miR-3151	CLIP-seq
MIRT1127974	hsa-miR-3187-5p	CLIP-seq
MIRT1127975	hsa-miR-3614-5p	CLIP-seq
MIRT1127976	hsa-miR-3913-5p	CLIP-seq
MIRT1127977	hsa-miR-3943	CLIP-seq
MIRT1127978	hsa-miR-424	CLIP-seq
MIRT1127979	hsa-miR-4298	CLIP-seq
MIRT1127980	hsa-miR-4300	CLIP-seq
MIRT1127981	hsa-miR-4505	CLIP-seq
MIRT1127982	hsa-miR-4527	CLIP-seq
MIRT1127983	hsa-miR-4642	CLIP-seq
MIRT1127984	hsa-miR-4645-5p	CLIP-seq
MIRT1127985	hsa-miR-4673	CLIP-seq
MIRT1127986	hsa-miR-4688	CLIP-seq
MIRT1127987	hsa-miR-4708-3p	CLIP-seq
MIRT1127988	hsa-miR-486-3p	CLIP-seq
MIRT1127989	hsa-miR-497	CLIP-seq
MIRT1127990	hsa-miR-541	CLIP-seq
MIRT1127991	hsa-miR-612	CLIP-seq
MIRT1127992	hsa-miR-663b	CLIP-seq
MIRT1127993	hsa-miR-890	CLIP-seq
MIRT1127994	hsa-miR-9	CLIP-seq
MIRT1127995	hsa-miR-920	CLIP-seq
MIRT1127996	hsa-miR-96	CLIP-seq
MIRT1127997	hsa-miR-19a	CLIP-seq
MIRT1127998	hsa-miR-19b	CLIP-seq
MIRT1127999	hsa-miR-518a-5p	CLIP-seq
MIRT1128000	hsa-miR-527	CLIP-seq
MIRT1128001	hsa-miR-595	CLIP-seq
MIRT1128002	hsa-miR-648	CLIP-seq
MIRT1127965	hsa-miR-15a	CLIP-seq
MIRT1127966	hsa-miR-15b	CLIP-seq
MIRT1127967	hsa-miR-16	CLIP-seq
MIRT1127970	hsa-miR-195	CLIP-seq
MIRT1551116	hsa-miR-214	CLIP-seq
MIRT1127978	hsa-miR-424	CLIP-seq
MIRT1127989	hsa-miR-497	CLIP-seq
MIRT1551117	hsa-miR-708	CLIP-seq
MIRT2036343	hsa-miR-1262	CLIP-seq
MIRT2036344	hsa-miR-1286	CLIP-seq
MIRT1127964	hsa-miR-1302	CLIP-seq
MIRT2036345	hsa-miR-146b-3p	CLIP-seq
MIRT2036346	hsa-miR-199a-5p	CLIP-seq
MIRT2036347	hsa-miR-199b-5p	CLIP-seq
MIRT2036348	hsa-miR-21	CLIP-seq
MIRT2036349	hsa-miR-2392	CLIP-seq
MIRT2036350	hsa-miR-2467-3p	CLIP-seq
MIRT2036351	hsa-miR-3064-5p	CLIP-seq
MIRT1127971	hsa-miR-3122	CLIP-seq
MIRT1127973	hsa-miR-3151	CLIP-seq
MIRT2036352	hsa-miR-3169	CLIP-seq
MIRT2036353	hsa-miR-3170	CLIP-seq
MIRT2036354	hsa-miR-3173-5p	CLIP-seq
MIRT2036355	hsa-miR-3189-3p	CLIP-seq
MIRT2036356	hsa-miR-3192	CLIP-seq
MIRT2036357	hsa-miR-34a	CLIP-seq
MIRT2036358	hsa-miR-34c-5p	CLIP-seq
MIRT1127975	hsa-miR-3614-5p	CLIP-seq
MIRT2036359	hsa-miR-3652	CLIP-seq
MIRT2036360	hsa-miR-377	CLIP-seq
MIRT1127976	hsa-miR-3913-5p	CLIP-seq
MIRT1127977	hsa-miR-3943	CLIP-seq
MIRT2036361	hsa-miR-4287	CLIP-seq
MIRT2036362	hsa-miR-4292	CLIP-seq
MIRT2036363	hsa-miR-4294	CLIP-seq
MIRT1127979	hsa-miR-4298	CLIP-seq
MIRT1127980	hsa-miR-4300	CLIP-seq
MIRT2036364	hsa-miR-4302	CLIP-seq
MIRT2036365	hsa-miR-4313	CLIP-seq
MIRT2036366	hsa-miR-4323	CLIP-seq
MIRT2036367	hsa-miR-4326	CLIP-seq
MIRT2036368	hsa-miR-4430	CLIP-seq
MIRT2036369	hsa-miR-4469	CLIP-seq
MIRT2036370	hsa-miR-449a	CLIP-seq
MIRT2036371	hsa-miR-449b	CLIP-seq
MIRT1127981	hsa-miR-4505	CLIP-seq
MIRT2036372	hsa-miR-4515	CLIP-seq
MIRT2036373	hsa-miR-4640-5p	CLIP-seq
MIRT1127983	hsa-miR-4642	CLIP-seq
MIRT1127984	hsa-miR-4645-5p	CLIP-seq
MIRT1127985	hsa-miR-4673	CLIP-seq
MIRT2036374	hsa-miR-4676-5p	CLIP-seq
MIRT2036375	hsa-miR-4685-3p	CLIP-seq
MIRT2036376	hsa-miR-4691-5p	CLIP-seq
MIRT2036377	hsa-miR-4701-3p	CLIP-seq
MIRT2036378	hsa-miR-4726-5p	CLIP-seq
MIRT2036379	hsa-miR-4792	CLIP-seq
MIRT1127990	hsa-miR-541	CLIP-seq
MIRT2036380	hsa-miR-575	CLIP-seq
MIRT2036381	hsa-miR-590-5p	CLIP-seq
MIRT2036382	hsa-miR-596	CLIP-seq
MIRT2036383	hsa-miR-635	CLIP-seq
MIRT1128002	hsa-miR-648	CLIP-seq
MIRT1127992	hsa-miR-663b	CLIP-seq
MIRT2036384	hsa-miR-874	CLIP-seq
MIRT2036385	hsa-miR-885-3p	CLIP-seq
MIRT1127995	hsa-miR-920	CLIP-seq
MIRT2036386	hsa-miR-924	CLIP-seq
MIRT1127959	hsa-miR-103a	CLIP-seq
MIRT1127960	hsa-miR-107	CLIP-seq
MIRT1127961	hsa-miR-1193	CLIP-seq
MIRT2266582	hsa-miR-1202	CLIP-seq
MIRT2266583	hsa-miR-1245b-5p	CLIP-seq
MIRT2036343	hsa-miR-1262	CLIP-seq
MIRT1127963	hsa-miR-1285	CLIP-seq
MIRT2036344	hsa-miR-1286	CLIP-seq
MIRT2266584	hsa-miR-1291	CLIP-seq
MIRT2036345	hsa-miR-146b-3p	CLIP-seq
MIRT2266585	hsa-miR-1825	CLIP-seq
MIRT2266586	hsa-miR-1908	CLIP-seq
MIRT2266587	hsa-miR-1910	CLIP-seq
MIRT2036346	hsa-miR-199a-5p	CLIP-seq
MIRT2036347	hsa-miR-199b-5p	CLIP-seq
MIRT1127997	hsa-miR-19a	CLIP-seq
MIRT1127998	hsa-miR-19b	CLIP-seq
MIRT2036348	hsa-miR-21	CLIP-seq
MIRT1551116	hsa-miR-214	CLIP-seq
MIRT2036349	hsa-miR-2392	CLIP-seq
MIRT2036350	hsa-miR-2467-3p	CLIP-seq
MIRT2266588	hsa-miR-300	CLIP-seq
MIRT2266589	hsa-miR-3142	CLIP-seq
MIRT2036352	hsa-miR-3169	CLIP-seq
MIRT2036354	hsa-miR-3173-5p	CLIP-seq
MIRT1127974	hsa-miR-3187-5p	CLIP-seq
MIRT2036355	hsa-miR-3189-3p	CLIP-seq
MIRT2036357	hsa-miR-34a	CLIP-seq
MIRT2036358	hsa-miR-34c-5p	CLIP-seq
MIRT2266590	hsa-miR-3620	CLIP-seq
MIRT2266591	hsa-miR-3650	CLIP-seq
MIRT2266592	hsa-miR-381	CLIP-seq
MIRT2266593	hsa-miR-3926	CLIP-seq
MIRT1127977	hsa-miR-3943	CLIP-seq
MIRT2266594	hsa-miR-3972	CLIP-seq
MIRT2266595	hsa-miR-4264	CLIP-seq
MIRT2266596	hsa-miR-4271	CLIP-seq
MIRT2266597	hsa-miR-4291	CLIP-seq
MIRT2036362	hsa-miR-4292	CLIP-seq
MIRT2036364	hsa-miR-4302	CLIP-seq
MIRT2036365	hsa-miR-4313	CLIP-seq
MIRT2036366	hsa-miR-4323	CLIP-seq
MIRT2036367	hsa-miR-4326	CLIP-seq
MIRT2266598	hsa-miR-4493	CLIP-seq
MIRT2036370	hsa-miR-449a	CLIP-seq
MIRT2036371	hsa-miR-449b	CLIP-seq
MIRT1127981	hsa-miR-4505	CLIP-seq
MIRT2036372	hsa-miR-4515	CLIP-seq
MIRT2266599	hsa-miR-455-3p	CLIP-seq
MIRT2036373	hsa-miR-4640-5p	CLIP-seq
MIRT1127983	hsa-miR-4642	CLIP-seq
MIRT1127984	hsa-miR-4645-5p	CLIP-seq
MIRT2266600	hsa-miR-4666-3p	CLIP-seq
MIRT1127985	hsa-miR-4673	CLIP-seq
MIRT2036374	hsa-miR-4676-5p	CLIP-seq
MIRT2036376	hsa-miR-4691-5p	CLIP-seq
MIRT2266601	hsa-miR-4695-3p	CLIP-seq
MIRT2036377	hsa-miR-4701-3p	CLIP-seq
MIRT2266602	hsa-miR-4701-5p	CLIP-seq
MIRT1127987	hsa-miR-4708-3p	CLIP-seq
MIRT2266603	hsa-miR-4725-3p	CLIP-seq
MIRT2036378	hsa-miR-4726-5p	CLIP-seq
MIRT2266604	hsa-miR-4747-5p	CLIP-seq
MIRT2266605	hsa-miR-4755-3p	CLIP-seq
MIRT2266606	hsa-miR-4776-3p	CLIP-seq
MIRT2036379	hsa-miR-4792	CLIP-seq
MIRT1127999	hsa-miR-518a-5p	CLIP-seq
MIRT2266607	hsa-miR-520g	CLIP-seq
MIRT2266608	hsa-miR-520h	CLIP-seq
MIRT1128000	hsa-miR-527	CLIP-seq
MIRT2036380	hsa-miR-575	CLIP-seq
MIRT2266609	hsa-miR-581	CLIP-seq
MIRT2266610	hsa-miR-584	CLIP-seq
MIRT2266611	hsa-miR-588	CLIP-seq
MIRT2036381	hsa-miR-590-5p	CLIP-seq
MIRT1128001	hsa-miR-595	CLIP-seq
MIRT1127991	hsa-miR-612	CLIP-seq
MIRT2036383	hsa-miR-635	CLIP-seq
MIRT2266612	hsa-miR-644	CLIP-seq
MIRT2266613	hsa-miR-646	CLIP-seq
MIRT1128002	hsa-miR-648	CLIP-seq
MIRT2266614	hsa-miR-663	CLIP-seq
MIRT1127992	hsa-miR-663b	CLIP-seq
MIRT2266615	hsa-miR-665	CLIP-seq
MIRT2036384	hsa-miR-874	CLIP-seq
MIRT1127993	hsa-miR-890	CLIP-seq
MIRT2266616	hsa-miR-922	CLIP-seq
MIRT1127983	hsa-miR-4642	CLIP-seq
MIRT2036343	hsa-miR-1262	CLIP-seq
MIRT2036344	hsa-miR-1286	CLIP-seq
MIRT2266586	hsa-miR-1908	CLIP-seq
MIRT2036346	hsa-miR-199a-5p	CLIP-seq
MIRT2036347	hsa-miR-199b-5p	CLIP-seq
MIRT2036352	hsa-miR-3169	CLIP-seq
MIRT2036364	hsa-miR-4302	CLIP-seq
MIRT2036372	hsa-miR-4515	CLIP-seq
MIRT2036374	hsa-miR-4676-5p	CLIP-seq
MIRT2036377	hsa-miR-4701-3p	CLIP-seq
MIRT2036379	hsa-miR-4792	CLIP-seq
MIRT2036380	hsa-miR-575	CLIP-seq
MIRT1128002	hsa-miR-648	CLIP-seq
MIRT2266614	hsa-miR-663	CLIP-seq
MIRT2266582	hsa-miR-1202	CLIP-seq
MIRT2036343	hsa-miR-1262	CLIP-seq
MIRT2036344	hsa-miR-1286	CLIP-seq
MIRT2266584	hsa-miR-1291	CLIP-seq
MIRT2036345	hsa-miR-146b-3p	CLIP-seq
MIRT2266585	hsa-miR-1825	CLIP-seq
MIRT2266586	hsa-miR-1908	CLIP-seq
MIRT2036350	hsa-miR-2467-3p	CLIP-seq
MIRT2036352	hsa-miR-3169	CLIP-seq
MIRT2266594	hsa-miR-3972	CLIP-seq
MIRT2036372	hsa-miR-4515	CLIP-seq
MIRT2036377	hsa-miR-4701-3p	CLIP-seq
MIRT2266606	hsa-miR-4776-3p	CLIP-seq
MIRT2266614	hsa-miR-663	CLIP-seq

Show/Hide all(48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IBA
GO:0000165	Process	MAPK cascade	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0001817	Process	Regulation of cytokine production	IEA
GO:0002931	Process	Response to ischemia	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004708	Function	MAP kinase kinase activity	IBA
GO:0004708	Function	MAP kinase kinase activity	IDA	8622669
GO:0004708	Function	MAP kinase kinase activity	IEA
GO:0004708	Function	MAP kinase kinase activity	TAS	7839144
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	11980910, 17255949, 19805025, 20067578, 20173330, 21044950, 21771788, 23602568, 31980649, 32707033, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	TAS	8622669
GO:0005829	Component	Cytosol	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	TAS	7839144
GO:0007507	Process	Heart development	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	11279118
GO:0031098	Process	Stress-activated protein kinase signaling cascade	IDA	35857590
GO:0031098	Process	Stress-activated protein kinase signaling cascade	IDA	8622669
GO:0031098	Process	Stress-activated protein kinase signaling cascade	IEA
GO:0035331	Process	Negative regulation of hippo signaling	IMP	27402810
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IMP	22696064
GO:0038066	Process	P38MAPK cascade	IEA
GO:0038066	Process	P38MAPK cascade	IMP	22696064
GO:0038066	Process	P38MAPK cascade	TAS
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IMP	22696064
GO:0045860	Process	Positive regulation of protein kinase activity	IDA	11980910
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	11980910
GO:0051604	Process	Protein maturation	IDA	32109412
GO:0060048	Process	Cardiac muscle contraction	IEA
GO:0070269	Process	Pyroptotic inflammatory response	IDA	32109412
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071493	Process	Cellular response to UV-B	IDA	35857590
GO:0072709	Process	Cellular response to sorbitol	IEA
GO:0090398	Process	Cellular senescence	IEA
GO:0090398	Process	Cellular senescence	TAS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1902531	Process	Regulation of intracellular signal transduction	IEA
GO:1904784	Process	NLRP1 inflammasome complex assembly	IDA	22665479

MIM	HGNC	e!Ensembl
602315	6843	ENSG00000034152

Protein

UniProt ID

P46734

Protein name

Dual specificity mitogen-activated protein kinase kinase 3 (MAP kinase kinase 3) (MAPKK 3) (EC 2.7.12.2) (MAPK/ERK kinase 3) (MEK 3) (Stress-activated protein kinase kinase 2) (SAPK kinase 2) (SAPKK-2) (SAPKK2)

Protein function

Dual specificity kinase. Is activated by cytokines and environmental stress in vivo. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinase p38. Part of a signaling cascade that begins with the activati

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	64 → 325	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Abundant expression is seen in the skeletal muscle. It is also widely expressed in other tissues.

Sequence

MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS

Sequence length

347

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Rap1 signaling pathway Cellular senescence Toll-like receptor signaling pathway Fc epsilon RI signaling pathway TNF signaling pathway Thermogenesis Inflammatory mediator regulation of TRP channels GnRH signaling pathway Growth hormone synthesis, secretion and action Alcoholic liver disease Amyotrophic lateral sclerosis Pathways of neurodegeneration - multiple diseases Salmonella infection Yersinia infection Toxoplasmosis Hepatitis B Epstein-Barr virus infection Human immunodeficiency virus 1 infection PD-L1 expression and PD-1 checkpoint pathway in cancer Lipid and atherosclerosis		Oxidative Stress Induced Senescence activated TAK1 mediates p38 MAPK activation Uptake and function of anthrax toxins

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alzheimer disease	Alzheimer's disease or family history of Alzheimer's disease	N/A	N/A	GWAS
Colorectal Cancer	Familial colorectal cancer	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS

Show/Hide Text Mining Associations (33)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Anorectal Malformations	Associate	29703930
Arthritis Rheumatoid	Associate	14695331, 14730602, 33483588
Autistic Disorder	Associate	18378158
Brain Diseases	Associate	18378158
Breast Neoplasms	Associate	12377770, 15677464, 19245689, 32873298
Carcinogenesis	Associate	24112539
Carcinoma Hepatocellular	Inhibit	24112539
Chemical and Drug Induced Liver Injury	Associate	32418112, 34299039
Colorectal Neoplasms	Associate	29703930, 31695024, 31881903, 37713993
Encephalitis Tick Borne	Associate	31122248
Fibromyalgia	Associate	37670381
Fibrosis	Associate	18614866
Gastroschisis	Associate	32163230
Glioblastoma	Associate	30894197
Glioma	Associate	17012236, 30894197
Heart Failure	Associate	12601168
Hepatitis C	Associate	18614866
Hepatitis Viral Human	Associate	34299039
Inflammation	Associate	14695331, 16230348, 28628118, 31156213
Intervertebral Disc Degeneration	Associate	24737428
Leukemia Lymphocytic Chronic B Cell	Associate	19779621
Melanoma	Associate	31257538
Mitochondrial Diseases	Associate	19245689
Neoplasm Metastasis	Associate	31257538
Neoplasms	Associate	20223820, 23319048, 24112539, 31242243, 31257538, 31881903, 35637967, 39979869
Neoplasms Mesothelial	Associate	14656993
Osteoarthritis	Associate	20955562
Papilloma Choroid Plexus	Associate	29703930
Paralysis	Associate	24737428
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	34830095
Prostatic Neoplasms	Associate	20168333
Prostatitis	Associate	8650201
Triple Negative Breast Neoplasms	Stimulate	32873298

MAP2K3 (mitogen-activated protein kinase kinase 3)