Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5603
Gene name Gene Name - the full gene name approved by the HGNC.	Mitogen-activated protein kinase 13
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MAPK13
Synonyms (NCBI Gene) Gene synonyms aliases	MAPK 13, MAPK-13, PRKM13, SAPK4, p38delta
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the mitogen-activated protein (MAP) kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, tra

Show/Hide all(137)

miRTarBase ID	miRNA	Experiments	Reference
MIRT519502	hsa-miR-18a-5p	PAR-CLIP	23446348
MIRT519501	hsa-miR-18b-5p	PAR-CLIP	23446348
MIRT519499	hsa-miR-4735-3p	PAR-CLIP	23446348
MIRT519500	hsa-miR-4761-5p	PAR-CLIP	23446348
MIRT519498	hsa-miR-6814-5p	PAR-CLIP	23446348
MIRT519497	hsa-miR-150-5p	PAR-CLIP	23446348
MIRT519496	hsa-miR-6778-3p	PAR-CLIP	23446348
MIRT519495	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT519494	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT462717	hsa-miR-4773	PAR-CLIP	23592263
MIRT462716	hsa-miR-4690-3p	PAR-CLIP	23592263
MIRT462715	hsa-miR-5685	PAR-CLIP	23592263
MIRT462714	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT462713	hsa-miR-4534	PAR-CLIP	23592263
MIRT462711	hsa-miR-8082	PAR-CLIP	23592263
MIRT462712	hsa-miR-3134	PAR-CLIP	23592263
MIRT462710	hsa-miR-4434	PAR-CLIP	23592263
MIRT462709	hsa-miR-4516	PAR-CLIP	23592263
MIRT462708	hsa-miR-5703	PAR-CLIP	23592263
MIRT462707	hsa-miR-5187-5p	PAR-CLIP	23592263
MIRT462706	hsa-miR-4525	PAR-CLIP	23592263
MIRT462705	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT462704	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT462702	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT462703	hsa-miR-4531	PAR-CLIP	23592263
MIRT462701	hsa-miR-3691-5p	PAR-CLIP	23592263
MIRT519502	hsa-miR-18a-5p	PAR-CLIP	23446348
MIRT519501	hsa-miR-18b-5p	PAR-CLIP	23446348
MIRT519499	hsa-miR-4735-3p	PAR-CLIP	23446348
MIRT519500	hsa-miR-4761-5p	PAR-CLIP	23446348
MIRT519498	hsa-miR-6814-5p	PAR-CLIP	23446348
MIRT519497	hsa-miR-150-5p	PAR-CLIP	23446348
MIRT519496	hsa-miR-6778-3p	PAR-CLIP	23446348
MIRT519495	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT519494	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT462717	hsa-miR-4773	PAR-CLIP	23592263
MIRT462716	hsa-miR-4690-3p	PAR-CLIP	23592263
MIRT462715	hsa-miR-5685	PAR-CLIP	23592263
MIRT462714	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT462713	hsa-miR-4534	PAR-CLIP	23592263
MIRT462711	hsa-miR-8082	PAR-CLIP	23592263
MIRT462712	hsa-miR-3134	PAR-CLIP	23592263
MIRT462710	hsa-miR-4434	PAR-CLIP	23592263
MIRT462709	hsa-miR-4516	PAR-CLIP	23592263
MIRT462708	hsa-miR-5703	PAR-CLIP	23592263
MIRT462707	hsa-miR-5187-5p	PAR-CLIP	23592263
MIRT462706	hsa-miR-4525	PAR-CLIP	23592263
MIRT462705	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT462704	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT462702	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT462703	hsa-miR-4531	PAR-CLIP	23592263
MIRT462701	hsa-miR-3691-5p	PAR-CLIP	23592263
MIRT1130354	hsa-miR-103a	CLIP-seq
MIRT1130355	hsa-miR-107	CLIP-seq
MIRT1130356	hsa-miR-122	CLIP-seq
MIRT1130357	hsa-miR-1276	CLIP-seq
MIRT1130358	hsa-miR-1288	CLIP-seq
MIRT1130359	hsa-miR-134	CLIP-seq
MIRT1130360	hsa-miR-200b	CLIP-seq
MIRT1130361	hsa-miR-200c	CLIP-seq
MIRT1130362	hsa-miR-2110	CLIP-seq
MIRT1130363	hsa-miR-3118	CLIP-seq
MIRT1130364	hsa-miR-3156-5p	CLIP-seq
MIRT1130365	hsa-miR-3164	CLIP-seq
MIRT1130366	hsa-miR-3189-3p	CLIP-seq
MIRT1130367	hsa-miR-320e	CLIP-seq
MIRT1130368	hsa-miR-34a	CLIP-seq
MIRT1130369	hsa-miR-34c-5p	CLIP-seq
MIRT1130370	hsa-miR-377	CLIP-seq
MIRT1130371	hsa-miR-3942-5p	CLIP-seq
MIRT1130372	hsa-miR-4251	CLIP-seq
MIRT1130373	hsa-miR-4271	CLIP-seq
MIRT1130374	hsa-miR-429	CLIP-seq
MIRT1130375	hsa-miR-4324	CLIP-seq
MIRT1130376	hsa-miR-4446-3p	CLIP-seq
MIRT1130377	hsa-miR-4463	CLIP-seq
MIRT1130378	hsa-miR-4476	CLIP-seq
MIRT1130379	hsa-miR-449a	CLIP-seq
MIRT1130380	hsa-miR-449b	CLIP-seq
MIRT1130381	hsa-miR-4501	CLIP-seq
MIRT1130382	hsa-miR-4504	CLIP-seq
MIRT1130383	hsa-miR-4533	CLIP-seq
MIRT1130384	hsa-miR-4632	CLIP-seq
MIRT1130385	hsa-miR-4656	CLIP-seq
MIRT1130386	hsa-miR-4667-5p	CLIP-seq
MIRT1130387	hsa-miR-4682	CLIP-seq
MIRT1130388	hsa-miR-4700-5p	CLIP-seq
MIRT1130389	hsa-miR-4703-5p	CLIP-seq
MIRT1130390	hsa-miR-4725-3p	CLIP-seq
MIRT1130391	hsa-miR-4765	CLIP-seq
MIRT1130392	hsa-miR-580	CLIP-seq
MIRT1130393	hsa-miR-619	CLIP-seq
MIRT1130394	hsa-miR-635	CLIP-seq
MIRT1130354	hsa-miR-103a	CLIP-seq
MIRT1130355	hsa-miR-107	CLIP-seq
MIRT1130356	hsa-miR-122	CLIP-seq
MIRT2037149	hsa-miR-3154	CLIP-seq
MIRT1130376	hsa-miR-4446-3p	CLIP-seq
MIRT2037150	hsa-miR-4452	CLIP-seq
MIRT1130377	hsa-miR-4463	CLIP-seq
MIRT1130382	hsa-miR-4504	CLIP-seq
MIRT1130385	hsa-miR-4656	CLIP-seq
MIRT1130387	hsa-miR-4682	CLIP-seq
MIRT2037151	hsa-miR-4742-3p	CLIP-seq
MIRT2037152	hsa-miR-4747-3p	CLIP-seq
MIRT1130391	hsa-miR-4765	CLIP-seq
MIRT2037153	hsa-miR-544	CLIP-seq
MIRT2037154	hsa-miR-630	CLIP-seq
MIRT1130364	hsa-miR-3156-5p	CLIP-seq
MIRT2267194	hsa-miR-3159	CLIP-seq
MIRT1130370	hsa-miR-377	CLIP-seq
MIRT1130376	hsa-miR-4446-3p	CLIP-seq
MIRT1130382	hsa-miR-4504	CLIP-seq
MIRT1130385	hsa-miR-4656	CLIP-seq
MIRT1130387	hsa-miR-4682	CLIP-seq
MIRT2267195	hsa-miR-541	CLIP-seq
MIRT2267196	hsa-miR-654-5p	CLIP-seq
MIRT1130354	hsa-miR-103a	CLIP-seq
MIRT1130355	hsa-miR-107	CLIP-seq
MIRT1130356	hsa-miR-122	CLIP-seq
MIRT1130357	hsa-miR-1276	CLIP-seq
MIRT1130358	hsa-miR-1288	CLIP-seq
MIRT2566995	hsa-miR-2355-5p	CLIP-seq
MIRT1130367	hsa-miR-320e	CLIP-seq
MIRT1130371	hsa-miR-3942-5p	CLIP-seq
MIRT2566996	hsa-miR-4320	CLIP-seq
MIRT2037150	hsa-miR-4452	CLIP-seq
MIRT1130378	hsa-miR-4476	CLIP-seq
MIRT1130383	hsa-miR-4533	CLIP-seq
MIRT1130384	hsa-miR-4632	CLIP-seq
MIRT1130389	hsa-miR-4703-5p	CLIP-seq
MIRT2037152	hsa-miR-4747-3p	CLIP-seq
MIRT1130391	hsa-miR-4765	CLIP-seq
MIRT2037153	hsa-miR-544	CLIP-seq
MIRT2037150	hsa-miR-4452	CLIP-seq
MIRT2037152	hsa-miR-4747-3p	CLIP-seq
MIRT2037153	hsa-miR-544	CLIP-seq

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	12244047, 15850461
GO:0004707	Function	MAP kinase activity	IBA	21873635
GO:0004707	Function	MAP kinase activity	IDA	9218798, 9731215
GO:0005515	Function	Protein binding	IPI	19135240, 22447027
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0006970	Process	Response to osmotic stress	IDA	9731215
GO:0007049	Process	Cell cycle	IEA
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	15850461
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	19279008
GO:0034644	Process	Cellular response to UV	IDA	9218798
GO:0035556	Process	Intracellular signal transduction	IBA	21873635
GO:0050729	Process	Positive regulation of inflammatory response	IC	19279008
GO:0051403	Process	Stress-activated MAPK cascade	IDA	9218798
GO:0070301	Process	Cellular response to hydrogen peroxide	IDA	9218798
GO:0071347	Process	Cellular response to interleukin-1	IDA	9218798
GO:0072709	Process	Cellular response to sorbitol	IDA	9218798
GO:0072740	Process	Cellular response to anisomycin	IDA	9218798
GO:1903936	Process	Cellular response to sodium arsenite	IDA	9218798

MIM	HGNC	e!Ensembl
602899	6875	ENSG00000156711

Protein

UniProt ID

O15264

Protein name

Mitogen-activated protein kinase 13 (MAP kinase 13) (MAPK 13) (EC 2.7.11.24) (Mitogen-activated protein kinase p38 delta) (MAP kinase p38 delta) (Stress-activated protein kinase 4)

Protein function

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK13 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli su

PDB

3COI , 4EYJ , 4EYM , 4MYG , 4YNO , 5EKN , 5EKO , 8X23

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	25 → 308	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in testes, pancreas, small intestine, lung and kidney. Abundant in macrophages, also present in neutrophils, CD4+ T-cells, and endothelial cells. {ECO:0000269|PubMed:10201954, ECO:0000269|PubMed:9374491}.

Sequence

MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGM
EFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAA
QALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKL

Sequence length

365

Interactions

View interactions

	KEGG		Reactome
	Endocrine resistance MAPK signaling pathway Rap1 signaling pathway FoxO signaling pathway Sphingolipid signaling pathway Oocyte meiosis Efferocytosis Cellular senescence Adrenergic signaling in cardiomyocytes VEGF signaling pathway Osteoclast differentiation Signaling pathways regulating pluripotency of stem cells Platelet activation Neutrophil extracellular trap formation Toll-like receptor signaling pathway NOD-like receptor signaling pathway RIG-I-like receptor signaling pathway C-type lectin receptor signaling pathway IL-17 signaling pathway Th1 and Th2 cell differentiation Th17 cell differentiation T cell receptor signaling pathway Fc epsilon RI signaling pathway TNF signaling pathway Leukocyte transendothelial migration Thermogenesis Neurotrophin signaling pathway Retrograde endocannabinoid signaling Dopaminergic synapse Inflammatory mediator regulation of TRP channels GnRH signaling pathway Progesterone-mediated oocyte maturation Prolactin signaling pathway Relaxin signaling pathway Non-alcoholic fatty liver disease AGE-RAGE signaling pathway in diabetic complications Growth hormone synthesis, secretion and action Alcoholic liver disease Amyotrophic lateral sclerosis Prion disease Pathways of neurodegeneration - multiple diseases Epithelial cell signaling in Helicobacter pylori infection Pathogenic Escherichia coli infection Shigellosis Salmonella infection Pertussis Yersinia infection Leishmaniasis Chagas disease Toxoplasmosis Tuberculosis Hepatitis B Human cytomegalovirus infection Kaposi sarcoma-associated herpesvirus infection Epstein-Barr virus infection Human immunodeficiency virus 1 infection Coronavirus disease - COVID-19 Proteoglycans in cancer Chemical carcinogenesis - reactive oxygen species PD-L1 expression and PD-1 checkpoint pathway in cancer Diabetic cardiomyopathy Lipid and atherosclerosis Fluid shear stress and atherosclerosis		NOD1/2 Signaling Pathway DSCAM interactions VEGFA-VEGFR2 Pathway

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Cholestasis	Cholestasis	rs121909103, rs751511532, rs376368459, rs762702807, rs1578490102, rs1578499691, rs1578504946, rs1317656688, rs199791850, rs1452792080, rs1578491039	20626112

Show/Hide Text Mining Associations (26)

Disease Name	Relationship Type	References
Associations from Text Mining
Arthritis Rheumatoid	Associate	11145021, 27898717
Asthma	Associate	40650018
Autistic Disorder	Associate	23088660
Autoimmune Diseases	Associate	34267747
Breast Neoplasms	Associate	19920204, 33213267
Carcinogenesis	Associate	28893210
Carcinoma Squamous Cell	Associate	27992079
Colorectal Neoplasms	Associate	31695024, 31881903
Diabetic Retinopathy	Associate	32993645
Dyslipidemias	Associate	35899893
Dysplastic Nevus Syndrome	Associate	24999589
Esophageal Squamous Cell Carcinoma	Inhibit	23722928
Esophageal Squamous Cell Carcinoma	Associate	25099621
Inflammation	Associate	14694199
Leiomyosarcoma	Associate	28893210
Leukemia Myeloid Acute	Associate	32102969
Macular Degeneration	Associate	28045574
Melanoma	Associate	24999589
Neoplasms	Associate	23722928, 27992079, 30485296, 31619506, 33213267, 34267747
Ovarian Neoplasms	Associate	28852147
Peritonitis	Associate	22836805
Pulmonary Embolism	Associate	24337368
Squamous Cell Carcinoma of Head and Neck	Associate	29747487
Stomach Neoplasms	Associate	30106143
Triple Negative Breast Neoplasms	Associate	27472710
Warts	Associate	32038103

MAPK13 (mitogen-activated protein kinase 13)