NXF5 (nuclear RNA export factor 5)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55998
Gene name Gene Name - the full gene name approved by the HGNC.
Nuclear RNA export factor 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NXF5
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq22.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is one member of a family of nuclear RNA export factor genes. The encoded protein can bind RNA, and is implicated in mRNA nuclear export. However, this protein has lost several C-terminal protein domains found in other family members that are re
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
miRTarBase ID miRNA Experiments Reference
MIRT1200445 hsa-miR-4650-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(10)
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding IBA 21873635
GO:0003723 Function RNA binding IDA 11566096
GO:0005515 Function Protein binding IPI 11566096
GO:0005634 Component Nucleus IBA 21873635
GO:0005634 Component Nucleus IDA 11566096
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
300319 8075 ENSG00000290798
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9H1B4
Protein name Nuclear RNA export factor 5 (TAP-like protein 1) (TAPL-1)
Protein function Could be involved in the export of mRNA from the nucleus to the cytoplasm. Could also have a role in polarized cytoplasmic transport and localization of mRNA in neurons.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09162 Tap-RNA_bind 10 → 92 Tap, RNA-binding Domain
Sequence 
MRRNTQDENMRKWFKVTIPYGIKYDKAWLMNSIQSNCSVPFTPVDFHYIRNRACFFVQVA
SAASALKDVSYKIYDDENQKICIFVSHFTAPYSVKNKLKPGQMEMLKLTMNKRYNVSQQA
LDLQNLRFDPDLMGRDIDIILNRRNCMAATLKITERNFPELLSLNLCNNKLYQLDGLSDI
TEKAPKVKTLNLSKNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSAIRDCFP
KLLRLDGRELSAPVIVDIDSSETMKPCKENFTGSETLKHLVLQFLQQSNLCKYFKDSRNI
KILKDPYLQRKLLKHTKCPRNVDSLSALPETQHDFTSILVDMWYQTVNTCFLPRAGPESQ
RWWCLLSLKWKDGLRVLILPSCGPSSLPLAAIPVCAS
Sequence length 397
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Focal segmental glomerulosclerosis Focal Segmental Glomerulosclerosis, Not Otherwise Specified rs267606877, rs267607183, rs267606878, rs267606879, rs267606880, rs121907909, rs74315343, rs121908415, rs121908416, rs121908417, rs1554181304, rs121434390, rs121434392, rs121434393, rs121434394
View all (39 more)		 23686279
Mental retardation Intellectual Disability rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)		 22030050
Show/Hide Text Mining Associations (3)
Associations from Text Mining
Disease Name Relationship Type References
Intellectual Disability Associate 23871722
Leiomyoma Associate 21685710
Primary Ovarian Insufficiency Associate 20338563