MAPK8 (mitogen-activated protein kinase 8)

Gene

• Entrez ID: 5599
• Gene name: Mitogen-activated protein kinase 8
• Gene symbol: MAPK8
• Synonyms (NCBI Gene): JNK, JNK-46, JNK1, JNK1A2, JNK21B1/2, PRKM8, SAPK1, SAPK1c
• Chromosome: 10
• Chromosome location: 10q11.22
• Summary: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003985	hsa-miR-199a-3p	Western blot	18456660
MIRT005427	hsa-miR-214-3p	GFP reporter assay, Microarray, qRT-PCR, Western blot	19859982
MIRT005427	hsa-miR-214-3p	GFP reporter assay, Microarray, qRT-PCR, Western blot	19859982
MIRT016104	hsa-miR-421	Sequencing	20371350
MIRT016510	hsa-miR-193b-3p	Microarray	20304954
MIRT021289	hsa-miR-125a-5p	Sequencing	20371350
MIRT021678	hsa-miR-140-3p	Sequencing	20371350
MIRT005427	hsa-miR-214-3p	Reporter assay;qRT-PCR;Microarray;Other	19859982
MIRT025602	hsa-miR-10a-5p	Sequencing	20371350
MIRT028235	hsa-miR-33a-5p	Sequencing	20371350
MIRT016104	hsa-miR-421	CLASH	23622248
MIRT037323	hsa-miR-877-5p	CLASH	23622248
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT566821	hsa-miR-4282	PAR-CLIP	20371350
MIRT473694	hsa-miR-497-3p	PAR-CLIP	20371350
MIRT536128	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT566820	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT566819	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT566818	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT566817	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT566816	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT566815	hsa-miR-548aw	PAR-CLIP	20371350
MIRT473699	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT473698	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT473697	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT473696	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT473695	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT473693	hsa-miR-193a-3p	PAR-CLIP	21572407
MIRT016510	hsa-miR-193b-3p	PAR-CLIP	21572407
MIRT473692	hsa-miR-892b	PAR-CLIP	21572407
MIRT473691	hsa-miR-4280	PAR-CLIP	21572407
MIRT473690	hsa-miR-3190-5p	PAR-CLIP	21572407
MIRT473689	hsa-miR-3926	PAR-CLIP	21572407
MIRT473688	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT473687	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT473686	hsa-miR-548s	PAR-CLIP	21572407
MIRT473685	hsa-miR-374b-3p	PAR-CLIP	21572407
MIRT441786	hsa-miR-3662	PAR-CLIP	22012620
MIRT441785	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT536130	hsa-miR-590-3p	PAR-CLIP	22012620
MIRT536129	hsa-miR-888-5p	PAR-CLIP	22012620
MIRT536128	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT536127	hsa-miR-371b-5p	PAR-CLIP	22012620
MIRT536126	hsa-miR-373-5p	PAR-CLIP	22012620
MIRT536125	hsa-miR-616-5p	PAR-CLIP	22012620
MIRT441784	hsa-miR-4480	PAR-CLIP	22012620
MIRT536124	hsa-miR-4775	PAR-CLIP	22012620
MIRT536123	hsa-miR-7703	PAR-CLIP	22012620
MIRT536122	hsa-miR-4325	PAR-CLIP	22012620
MIRT536121	hsa-miR-450b-5p	PAR-CLIP	22012620
MIRT536120	hsa-miR-507	PAR-CLIP	22012620
MIRT536119	hsa-miR-557	PAR-CLIP	22012620
MIRT501958	hsa-miR-3680-3p	PAR-CLIP	22012620
MIRT501966	hsa-miR-203a-3p	PAR-CLIP	24398324
MIRT501967	hsa-miR-33b-5p	PAR-CLIP	24398324
MIRT028235	hsa-miR-33a-5p	PAR-CLIP	24398324
MIRT501966	hsa-miR-203a-3p	PAR-CLIP	24398324
MIRT501965	hsa-miR-126-5p	PAR-CLIP	24398324
MIRT501964	hsa-miR-664a-3p	PAR-CLIP	24398324
MIRT501962	hsa-miR-8060	PAR-CLIP	24398324
MIRT501963	hsa-miR-496	PAR-CLIP	24398324
MIRT501961	hsa-miR-4795-3p	PAR-CLIP	24398324
MIRT501960	hsa-miR-7154-5p	PAR-CLIP	24398324
MIRT501959	hsa-miR-433-3p	PAR-CLIP	24398324
MIRT501958	hsa-miR-3680-3p	PAR-CLIP	24398324
MIRT473699	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT473698	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT473697	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT473696	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT473695	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT473694	hsa-miR-497-3p	PAR-CLIP	23592263
MIRT473693	hsa-miR-193a-3p	PAR-CLIP	23592263
MIRT016510	hsa-miR-193b-3p	PAR-CLIP	23592263
MIRT473692	hsa-miR-892b	PAR-CLIP	23592263
MIRT473691	hsa-miR-4280	PAR-CLIP	23592263
MIRT473690	hsa-miR-3190-5p	PAR-CLIP	23592263
MIRT473689	hsa-miR-3926	PAR-CLIP	23592263
MIRT473688	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT473687	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT473686	hsa-miR-548s	PAR-CLIP	23592263
MIRT473685	hsa-miR-374b-3p	PAR-CLIP	23592263
MIRT441786	hsa-miR-3662	PAR-CLIP	22100165
MIRT441785	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT441783	hsa-miR-3163	PAR-CLIP	22100165
MIRT441784	hsa-miR-4480	PAR-CLIP	22100165
MIRT736095	hsa-miR-141-3p	qRT-PCR	33133155
MIRT566821	hsa-miR-4282	PAR-CLIP	20371350
MIRT473694	hsa-miR-497-3p	PAR-CLIP	20371350
MIRT536128	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT566820	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT566819	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT566818	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT566817	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT566816	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT566815	hsa-miR-548aw	PAR-CLIP	20371350
MIRT473699	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT473698	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT473697	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT473696	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT473695	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT473693	hsa-miR-193a-3p	PAR-CLIP	21572407
MIRT016510	hsa-miR-193b-3p	PAR-CLIP	21572407
MIRT473692	hsa-miR-892b	PAR-CLIP	21572407
MIRT473691	hsa-miR-4280	PAR-CLIP	21572407
MIRT473690	hsa-miR-3190-5p	PAR-CLIP	21572407
MIRT473689	hsa-miR-3926	PAR-CLIP	21572407
MIRT473688	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT473687	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT473686	hsa-miR-548s	PAR-CLIP	21572407
MIRT473685	hsa-miR-374b-3p	PAR-CLIP	21572407
MIRT441786	hsa-miR-3662	PAR-CLIP	22012620
MIRT441785	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT536130	hsa-miR-590-3p	PAR-CLIP	22012620
MIRT536129	hsa-miR-888-5p	PAR-CLIP	22012620
MIRT536128	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT536127	hsa-miR-371b-5p	PAR-CLIP	22012620
MIRT536126	hsa-miR-373-5p	PAR-CLIP	22012620
MIRT536125	hsa-miR-616-5p	PAR-CLIP	22012620
MIRT441784	hsa-miR-4480	PAR-CLIP	22012620
MIRT536124	hsa-miR-4775	PAR-CLIP	22012620
MIRT536123	hsa-miR-7703	PAR-CLIP	22012620
MIRT536122	hsa-miR-4325	PAR-CLIP	22012620
MIRT536121	hsa-miR-450b-5p	PAR-CLIP	22012620
MIRT536120	hsa-miR-507	PAR-CLIP	22012620
MIRT536119	hsa-miR-557	PAR-CLIP	22012620
MIRT501958	hsa-miR-3680-3p	PAR-CLIP	22012620
MIRT501966	hsa-miR-203a-3p	PAR-CLIP	24398324
MIRT501967	hsa-miR-33b-5p	PAR-CLIP	24398324
MIRT028235	hsa-miR-33a-5p	PAR-CLIP	24398324
MIRT501966	hsa-miR-203a-3p	PAR-CLIP	24398324
MIRT501965	hsa-miR-126-5p	PAR-CLIP	24398324
MIRT501964	hsa-miR-664a-3p	PAR-CLIP	24398324
MIRT501962	hsa-miR-8060	PAR-CLIP	24398324
MIRT501963	hsa-miR-496	PAR-CLIP	24398324
MIRT501961	hsa-miR-4795-3p	PAR-CLIP	24398324
MIRT501960	hsa-miR-7154-5p	PAR-CLIP	24398324
MIRT501959	hsa-miR-433-3p	PAR-CLIP	24398324
MIRT501958	hsa-miR-3680-3p	PAR-CLIP	24398324
MIRT473699	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT473698	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT473697	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT473696	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT473695	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT473694	hsa-miR-497-3p	PAR-CLIP	23592263
MIRT473693	hsa-miR-193a-3p	PAR-CLIP	23592263
MIRT016510	hsa-miR-193b-3p	PAR-CLIP	23592263
MIRT473692	hsa-miR-892b	PAR-CLIP	23592263
MIRT473691	hsa-miR-4280	PAR-CLIP	23592263
MIRT473690	hsa-miR-3190-5p	PAR-CLIP	23592263
MIRT473689	hsa-miR-3926	PAR-CLIP	23592263
MIRT473688	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT473687	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT473686	hsa-miR-548s	PAR-CLIP	23592263
MIRT473685	hsa-miR-374b-3p	PAR-CLIP	23592263
MIRT441786	hsa-miR-3662	PAR-CLIP	22100165
MIRT441785	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT441783	hsa-miR-3163	PAR-CLIP	22100165
MIRT441784	hsa-miR-4480	PAR-CLIP	22100165
MIRT473699	hsa-miR-30a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35001794
MIRT2037380	hsa-miR-1244	CLIP-seq
MIRT2037381	hsa-miR-3168	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
E2F1	Unknown	20800677
E2F3	Unknown	20800677
HSF2	Repression	11557063
JUN	Activation	19324081
JUN	Unknown	16397260

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	14967141, 15850461, 20027304, 21095239, 22966201
GO:0004705	Function	JUN kinase activity	IBA	21873635
GO:0004705	Function	JUN kinase activity	IDA	8654373, 21095239
GO:0004705	Function	JUN kinase activity	TAS
GO:0004707	Function	MAP kinase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	10393177, 10490659, 10747973, 10856240, 11517249, 15334056, 15894542, 16291755, 16533805, 16840345, 16982329, 18003900, 18286207, 19234442, 19527717, 22966201, 23397142, 25241761, 25284480, 27043084
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	20027304, 30878395
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	IDA	21856198
GO:0006468	Process	Protein phosphorylation	IMP	22441692
GO:0006979	Process	Response to oxidative stress	IDA	22966201
GO:0007254	Process	JNK cascade	IBA	21873635
GO:0007254	Process	JNK cascade	IDA	8654373
GO:0007254	Process	JNK cascade	TAS
GO:0007258	Process	JUN phosphorylation	IDA	14967141, 21095239
GO:0009411	Process	Response to UV	IDA	14967141
GO:0009612	Process	Response to mechanical stimulus	IBA	21873635
GO:0010628	Process	Positive regulation of gene expression	IMP	22065586
GO:0016241	Process	Regulation of macroautophagy	TAS	26546165
GO:0016301	Function	Kinase activity	TAS
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	15850461, 20027304, 21095239, 22966201
GO:0018107	Process	Peptidyl-threonine phosphorylation	IDA	21095239
GO:0018107	Process	Peptidyl-threonine phosphorylation	IMP	20027304
GO:0019899	Function	Enzyme binding	IPI	14615289
GO:0030424	Component	Axon	ISS	22683681
GO:0031063	Process	Regulation of histone deacetylation	IEA
GO:0031281	Process	Positive regulation of cyclase activity	IMP	22027397
GO:0032091	Process	Negative regulation of protein binding	IDA	21095239
GO:0032880	Process	Regulation of protein localization	IDA	20027304
GO:0034198	Process	Cellular response to amino acid starvation	IDA	11096076
GO:0034614	Process	Cellular response to reactive oxygen species	IMP	26514923
GO:0035033	Function	Histone deacetylase regulator activity	IMP	20027304
GO:0035556	Process	Intracellular signal transduction	IBA	21873635
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0042826	Function	Histone deacetylase binding	IPI	20027304
GO:0043065	Process	Positive regulation of apoptotic process	IBA	21873635
GO:0043065	Process	Positive regulation of apoptotic process	TAS
GO:0043066	Process	Negative regulation of apoptotic process	IDA	14967141, 21095239
GO:0045202	Component	Synapse	ISS
GO:0048511	Process	Rhythmic process	IEA
GO:0051090	Process	Regulation of DNA-binding transcription factor activity	TAS
GO:0051247	Process	Positive regulation of protein metabolic process	IMP	22027397
GO:0051403	Process	Stress-activated MAPK cascade	IDA	11096076
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	23776175
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0071276	Process	Cellular response to cadmium ion	IMP	26514923
GO:0071345	Process	Cellular response to cytokine stimulus	TAS
GO:0090045	Process	Positive regulation of deacetylase activity	IMP	20027304
GO:0097441	Component	Basal dendrite	ISS	22683681
GO:1900740	Process	Positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS
GO:1902595	Process	Regulation of DNA replication origin binding	IMP	21856198

Other IDs

• MIM: 601158
• HGNC: 6881
• e!Ensembl: ENSG00000107643

Protein

• UniProt ID: P45983
• Protein name: Mitogen-activated protein kinase 8 (MAP kinase 8) (MAPK 8) (EC 2.7.11.24) (JNK-46) (Stress-activated protein kinase 1c) (SAPK1c) (Stress-activated protein kinase JNK1) (c-Jun N-terminal kinase 1)
• Protein function: Serine/threonine-protein kinase involved in various processes such as cell proliferation, differentiation, migration, transformation and programmed cell death. Extracellular stimuli such as pro-inflammatory cytokines or physical stress stimulate
• PDB: 1UKH, 1UKI, 2G01, 2GMX, 2H96, 2NO3, 2XRW, 2XS0, 3ELJ, 3O17, 3O2M, 3PZE, 3V3V, 3VUD, 3VUG, 3VUH, 3VUI, 3VUK, 3VUL, 3VUM, 4AWI, 4E73, 4G1W, 4HYS, 4HYU, 4IZY, 4L7F, 4QTD, 4UX9, 4YR8, 5LW1, 6F5E, 6ZR5, 8PT8, 8PT9, 8PTA, 8R5E, 8X5M, 9FT9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	26 → 321	Protein kinase domain	Domain

• Sequence:

  MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
  FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
  MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
  MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
  LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
  MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
  MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAA
  GPLGCCR

• Sequence length: 427

Pathways

KEGG:

Endocrine resistance
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
cAMP signaling pathway
FoxO signaling pathway
Sphingolipid signaling pathway
Mitophagy - animal
Autophagy - animal
Protein processing in endoplasmic reticulum
Apoptosis
Apoptosis - multiple species
Necroptosis
Wnt signaling pathway
Osteoclast differentiation
Focal adhesion
Tight junction
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
C-type lectin receptor signaling pathway
IL-17 signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Prolactin signaling pathway
Adipocytokine signaling pathway
Relaxin signaling pathway
Type II diabetes mellitus
Insulin resistance
Non-alcoholic fatty liver disease
AGE-RAGE signaling pathway in diabetic complications
Growth hormone synthesis, secretion and action
Alcoholic liver disease
Alzheimer disease
Parkinson disease
Huntington disease
Spinocerebellar ataxia
Prion disease
Pathways of neurodegeneration - multiple diseases
Epithelial cell signaling in Helicobacter pylori infection
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Pertussis
Yersinia infection
Chagas disease
Toxoplasmosis
Tuberculosis
Hepatitis B
Measles
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
Coronavirus disease - COVID-19
Pathways in cancer
Chemical carcinogenesis - reactive oxygen species
Colorectal cancer
Pancreatic cancer
Choline metabolism in cancer
Diabetic cardiomyopathy
Lipid and atherosclerosis
Fluid shear stress and atherosclerosis

Reactome:

Activation of BIM and translocation to mitochondria
Activation of BMF and translocation to mitochondria
NRAGE signals death through JNK
Oxidative Stress Induced Senescence
FCERI mediated MAPK activation
DSCAM interactions
JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1
Activation of the AP-1 family of transcription factors
Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks
Interleukin-38 signaling
WNT5:FZD7-mediated leishmania damping

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Cholestasis	Cholestasis, Extrahepatic	rs121909103, rs751511532, rs376368459, rs762702807, rs1578490102, rs1578499691, rs1578504946, rs1317656688, rs199791850, rs1452792080, rs1578491039	28789951
Dermatitis	Dermatitis, Atopic	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	24046278
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802, rs28933369, rs121912469, rs80358011, rs397507262, rs80359439, rs397507333, rs80359543, rs80358831, rs80359596, rs80358920, rs80358972, rs80359659, rs397507404, rs397514661, rs80359516, rs200495564, rs80358419, rs80359274, rs80359283, rs80358427, rs80358428, rs80358435, rs81002805, rs397507660, rs397507663, rs80359391, rs80359443, rs81002797, rs80359466, rs397507752, rs80359484, rs80359603, rs397507954, rs80359058, rs80359071, rs397507981, rs80359121, rs80357086, rs80357064, rs397508936, rs80357695, rs80357661, rs397509035, rs80357544, rs80357577, rs80357881, rs80357296, rs80356923, rs80356866, rs80357504, rs80357390, rs80357239, rs80358099, rs397509284, rs80357258, rs199474738, rs199474747, rs587779204, rs63750439, rs267608076, rs587779246, rs63749999, rs267608078, rs63751327, rs267607719, rs267607734, rs63750706, rs63751711, rs587779047, rs587779075, rs267607949, rs63750633, rs63750803, rs63751618, rs267608154, rs200640585, rs80358018, rs80357857, rs80357882, rs180177103, rs587779815, rs587779865, rs587779872, rs587780059, rs121912666, rs587780088, rs587780104, rs200432447, rs180177100, rs587780226, rs587780784, rs587776416, rs587781276, rs587781629, rs587781694, rs587781727, rs587781730, rs587781807, rs587781894, rs587781948, rs121913344, rs587782292, rs587782350, rs587782558, rs587782719, rs587782885, rs587783057, rs730881833, rs730881411, rs730881336, rs139770721, rs730881869, rs730881633, rs730882007, rs786203115, rs765123255, rs1553333738, rs762083530, rs786202800, rs17174393, rs55996097, rs750621215, rs786203451, rs747604569, rs764389018, rs786204433, rs786204862, rs772821016, rs779582317, rs863225406, rs193922343, rs759965045, rs63749919, rs760228510, rs746481984, rs762307622, rs876659736, rs876660933, rs747727055, rs1450394308, rs876658348, rs876658431, rs876659326, rs876660444, rs730881369, rs878853865, rs753862052, rs587780024, rs138941496, rs886040739, rs886040744, rs886040347, rs878854957, rs886040123, rs398122662, rs886040942, rs1057517104, rs1057516320, rs1057516683, rs879254046, rs1057517253, rs587781927, rs985033810, rs1057519989, rs775464903, rs374230313, rs758304323, rs1060501599, rs758081262, rs1060500126, rs1060502734, rs587776408, rs1060501695, rs1114167816, rs1114167596, rs1114167667, rs1555460315, rs1135402788, rs1554086196, rs730881919, rs773356478, rs769237459, rs1553653158, rs587782087, rs1555107263, rs1555119940, rs1403784434, rs1342519012, rs751710099, rs1553616361, rs1553619721, rs1270783041, rs775036118, rs1555288557, rs1555460548, rs1555461154, rs1298667185, rs1553622218, rs63751101, rs1349928568, rs771936821, rs1021662947, rs1555921011, rs81002831, rs1555124506, rs1555574803, rs1060502716, rs1555605362, rs747057367, rs1565385010, rs1567554500, rs1567516230, rs1558644995, rs1555591308, rs778306619, rs1566231194, rs1603328466, rs1570406302, rs1586108714, rs768362387, rs1597713777, rs1060502926, rs1597867185, rs1591517571, rs1591663236, rs1593903006, rs1555284779, rs1597096243, rs45459799, rs1597360340, rs587781905, rs864622481, rs1601753141, rs1966858562, rs1966967065, rs1967016153, rs1967113484, rs2080473458, rs1591387978, rs1224428422, rs1597747184, rs2082309297, rs2051929740, rs147542208	18593901
Glioblastoma	Glioblastoma Multiforme	rs121913500, rs886042842, rs1555138291, rs1558518449, rs1567176006, rs1558650888
Liver failure	Liver Failure, Acute	rs118203990, rs118203991, rs118203992, rs387907022, rs201861847, rs796065037, rs759315662, rs368196005, rs796052121, rs369437593, rs367683258, rs766314948, rs368085185, rs770446752, rs753039116, rs776797592, rs1490906786, rs1562849964, rs759960319, rs776597537, rs375350359, rs1573008071, rs1601977105, rs1174791046, rs1019313682	17185352
Renal carcinoma	Conventional (Clear Cell) Renal Cell Carcinoma	rs121913668, rs121913670, rs121913243, rs786202724
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	24284070

Unknown
Disease term	Disease name	Evidence	References	Source
Mental depression	Mental Depression, Depressive disorder		11751189, 21669197	ClinVar

Associations from Text Mining
Disease Name	Relationship Type	References
3 methylcrotonyl CoA carboxylase 1 deficiency	Associate	26655088
AA amyloidosis	Inhibit	14997933
Acquired Immunodeficiency Syndrome	Associate	37798121
Acute Coronary Syndrome	Associate	25997853
Acute Kidney Injury	Stimulate	34962918
Adenocarcinoma of Lung	Associate	33299528, 33361736
Adenoma	Associate	23082052
Adjustment Disorders	Associate	15830375
Adrenoleukodystrophy	Associate	37974207
Alexander Disease	Associate	17038307
Alzheimer Disease	Associate	12917434, 19162185, 21811019, 27106634, 40074652
Alzheimer Disease	Stimulate	23095849, 26924229, 37236204
Alzheimer Disease	Inhibit	24346217
Amyotrophic Lateral Sclerosis	Associate	28366453, 37386082
Anemia Diamond Blackfan	Associate	26258650
Anemia Sickle Cell	Associate	24515990
Aneurysm Ascending Aorta	Associate	26071572
Aniridia	Associate	40570009
Aortic Aneurysm	Associate	17478756
Aortic Aneurysm Abdominal	Associate	18502079
Arteriosclerosis Obliterans	Associate	36474716
Arthritis	Associate	13130464
Arthritis	Stimulate	21953337
Arthritis Rheumatoid	Associate	16802349, 16936264, 17530707, 18713996, 20185962, 20878914, 22183962, 29191214, 31022596, 32131874, 32670287, 33426091, 33952303, 35967391, 36934132
Arthritis Rheumatoid	Stimulate	21953337
Asthma	Associate	22205926
Astrocytoma	Associate	10501211, 17971243, 19543395
Ataxia Telangiectasia	Associate	9830038
Atherosclerosis	Inhibit	18385538
Atherosclerosis	Associate	20404041, 21070853
Atypical Squamous Cells of the Cervix	Associate	23651874
Autism Spectrum Disorder	Associate	21935439
Autonomic Nervous System Diseases	Associate	12058026
Blood Platelet Disorders	Associate	29436605
Bone Diseases	Associate	17255354, 33748269
Brain Ischemia	Associate	30066915
Brain Neoplasms	Stimulate	15637069
Breast Neoplasms	Associate	10618392, 11983707, 16450001, 16684880, 16984917, 17371872, 17846503, 18022396, 19133231, 19543320, 19674193, 19775288, 19819984, 20482821, 20507565, 21719561, 22087220, 22121046, 22446103, 22952942, 23902710, 24019090, 24289581, 25629224, 25781201, 25791820, 26116171, 26607805, 26735495, 27045589, 29207138, 29348172, 30873742, 31766464, 32427938, 32947764, 33066575, 34369076, 34572567, 35234274, 36210461, 36234680, 36550279, 36656864, 37110684, 37400459, 37789226, 38048919, 38412255, 40468448, 40657389, 9813039
Breast Neoplasms	Inhibit	36656864
Burkitt Lymphoma	Associate	20551953, 24787013
Calcinosis	Associate	26515875, 27001263
Calcinosis Cutis	Associate	24466137, 26808375
Candidiasis Chronic Mucocutaneous	Associate	31784499
Carcinogenesis	Associate	17416736, 17699782, 23922701, 26790956, 27268017, 33749640, 36693850
Carcinoma Ductal Breast	Associate	21502402
Carcinoma Endometrioid	Associate	35883247
Carcinoma Hepatocellular	Associate	18620777, 19041150, 19686584, 19835603, 20632440, 20856226, 22323130, 23035214, 23392177, 24135379, 24637780, 25053598, 25091573, 25522777, 26057631, 26095609, 26231035, 26258887, 26517516, 26648552, 26707143, 26718209, 26790956, 26799423, 26884857, 26939902, 26964667, 27046040, 27049263, 27367026, 27431384, 27492456, 28507277, 28584306, 28665449, 28869833, 29445085, 29728125, 29748591, 29749550, 31056532, 31597595, 31786862, 32161315, 32350244, 34559939, 34657150, 35311629, 35866605, 37021545, 37215991
Carcinoma Intraductal Noninfiltrating	Associate	40468448
Carcinoma Non Small Cell Lung	Associate	10022884, 14965369, 15705594, 16179969, 19168796, 22076560, 25095981, 25566961, 26362062, 26549806, 26993769, 27726288, 32554486, 32554853, 33896822, 33955133, 38102661, 38167059
Carcinoma Non Small Cell Lung	Stimulate	15173070
Carcinoma Ovarian Epithelial	Associate	26098087, 28666421, 34638596
Carcinoma Pancreatic Ductal	Associate	31243599, 33341545
Carcinoma Papillary	Associate	15119004
Carcinoma Renal Cell	Associate	22493490, 22991494, 24576174, 33151174, 33804101
Carcinoma Renal Cell	Stimulate	37960824
Carcinoma Squamous Cell	Associate	11792626, 23557251, 23651874, 32521923, 37805058
Cardiomegaly	Associate	37972803
Cardiovascular Diseases	Associate	36012132
Carotid Stenosis	Associate	26254334
Celiac Disease	Associate	15357947
Cerebellar Diseases	Associate	25062847
Cerebral Infarction	Associate	28546532
Chemical and Drug Induced Liver Injury	Associate	25080058, 34198988
Chemotherapy Related Cognitive Impairment	Associate	26993769
Cholangiocarcinoma	Associate	24587347, 28535665, 28662515, 30305612, 30850583, 32246704, 33431813
Cholestasis	Associate	31316180
Chondrosarcoma	Associate	12587980, 23892595
Chromosome Disorders	Associate	37963657
Chronobiology Disorders	Associate	21418516
Ciliary Dyskinesia With Transposition Of Ciliary Microtubules	Associate	10075725
Colitis Ulcerative	Stimulate	23742011
Colitis Ulcerative	Associate	24118792, 28751935
Colonic Neoplasms	Associate	16449643, 31366902
Colonic Neoplasms	Stimulate	37960824
Colorectal Neoplasms	Associate	16024641, 19290007, 19352384, 19499154, 21524306, 22681760, 22870247, 22922338, 23907464, 24733045, 25124618, 25178491, 26235743, 27216154, 27440078, 27713159, 27926494, 28068431, 28402256, 28606091, 29138007, 29451183, 30035680, 30482246, 31331640, 31506433, 31892852, 31906747, 32167616, 32260423, 32408577, 33355370, 33749640, 33961948, 34418232, 34572494, 35590292, 35758246, 36047191, 36200182, 36581088, 36693850, 36806631, 37530327, 39275334
Connective Tissue Diseases	Associate	31784499
Contracture	Associate	19214689
Corneal Injuries	Associate	32016117
Coronary Artery Disease	Associate	35801781, 36184551
Corticobasal Degeneration	Associate	35976433
Corticosteroid Binding Globulin Deficiency	Associate	27013170
COVID 19	Associate	33260035, 35213582, 35855804
Craniosynostoses	Associate	23073384
Crohn Disease	Associate	26215868, 31415355
Crohn Disease	Stimulate	30765731
Cystic Disease Of Lung	Associate	34962918
Cysts	Associate	11849444
Cytokine Release Syndrome	Associate	31951974
Cytomegalovirus Infections	Associate	23376463
Death	Associate	15308849, 29343514, 32060308, 33488943, 35367758, 40557871, 9603971
Dementia	Associate	27106634
Dermatitis Atopic	Associate	29498756
Diabetes Gestational	Associate	36263320
Diabetes Mellitus	Associate	18263705, 25999017, 26800561, 28367848, 30478982
Diabetes Mellitus Type 2	Associate	21931634, 23110196, 27106634, 35712257, 37680885
Diabetic Nephropathies	Associate	33274236
Disease	Associate	34962918
Dissociative Disorders	Associate	23951008
Distal myopathy Nonaka type	Associate	33602173
Drug Related Side Effects and Adverse Reactions	Associate	12149148, 12244106, 19147541, 19910452, 22222766, 22462553, 24515671, 25473894, 25685256, 26699492, 28931802, 28993908, 31056532, 31118030, 31159592, 31251836, 37375646
Drug Related Side Effects and Adverse Reactions	Stimulate	17384201, 17925029, 28394191, 28988120
Dysautonomia Familial	Associate	12058026
Dysplastic Nevus Syndrome	Associate	11849444
Emphysema	Associate	24988221
Encephalitis Herpes Simplex	Associate	19549704
Endometriosis	Associate	23411497, 25207642, 30259980, 37164275
Epstein Barr Virus Infections	Associate	36768307
Esophageal Neoplasms	Stimulate	23921907
Esophageal Squamous Cell Carcinoma	Associate	37705202
Familial cylindromatosis	Inhibit	22832488
Fanconi Anemia	Stimulate	12958075
Fatigue	Stimulate	37915075
Fatty Liver	Associate	26497211
Fatty Liver Alcoholic	Associate	30248539
Fibrosarcoma	Associate	10064600, 19368127, 20590612
Fibrosis	Associate	24434780, 25175743, 27385084, 30217824, 35176481
Gastroesophageal Reflux	Stimulate	33850461
Gerodermia osteodysplastica	Associate	32735324
Gingival Overgrowth	Associate	24445011
Glaucoma	Associate	33707187
Glioblastoma	Associate	17647244, 17699104, 19894226, 24732116, 24967005, 26871431, 28097126, 28487380, 31390836, 32060308, 32065482, 35173528, 35367758, 35814563, 9162025
Glioma	Associate	18281515, 19583803, 20452983, 25596741, 25792385, 26439036, 27291091, 28449039, 31053160, 31772693, 32003751, 33920356, 34227028, 36291099, 37277492
Glioma of Brain Familial	Associate	22938480
Glomerulonephritis	Associate	33043579
Glomerulonephritis Membranous	Associate	35172688
Glucose Intolerance	Associate	22351776
Glucosephosphate Dehydrogenase Deficiency	Associate	18842828
Glut1 Deficiency Syndrome	Associate	19438816
Glycogen Storage Disease Type II	Associate	23940728
Glycosuria Renal	Associate	9497315
Gout	Associate	32630231
Granulosa Cell Tumor	Associate	33039870
Granulosa cell tumor of the ovary	Associate	26261481
HAIR AN syndrome	Associate	23110196
Heart Diseases	Associate	35673578
Heart Failure	Associate	28367848
Helicobacter Infections	Associate	35350782
Hemimegalencephaly	Associate	16196383
Hemolytic Uremic Syndrome	Stimulate	37703866
Hepatitis B	Associate	26648552, 32293395, 36916737
Hepatitis C	Stimulate	28931802
Hepatitis C	Associate	28935193
Hepatolenticular Degeneration	Associate	26660341
Hereditary Breast and Ovarian Cancer Syndrome	Stimulate	16002723
HIV Infections	Associate	15270850, 29170390, 37798121
Hypercholesterolemia	Associate	30709899
Hyperinsulinism	Associate	34034759
Hypertension Portal	Associate	31934265
Hypertension Pulmonary	Associate	24515990
Hypertrophy Left Ventricular	Associate	29506515
Hypoglycemia	Associate	9115218
Hypothalamic hamartomas	Associate	25307426
Hypothermia	Inhibit	19596001
Hypoxia	Stimulate	12213726, 23681233, 24477234, 25583406, 26924229, 32377698
Hypoxia	Associate	16732616, 20491781, 20559021, 25573199, 27216154, 29843131
Hypoxia Brain	Associate	24515990, 28618937
Hypoxia Brain	Stimulate	26924229, 34624938, 36674983
Infections	Associate	12714616, 17643099, 22727020, 23797008, 30333178
Infections	Stimulate	23871663, 32513853
Infertility Male	Associate	36497065
Inflammation	Associate	11145674, 12832416, 16489115, 16802342, 16879221, 17386086, 18653246, 18772336, 18842828, 19162185, 20728939, 21611183, 21744278, 21921033, 22562303, 23110196, 23632636, 23690070, 23797008, 24434780, 24515990, 24759787, 24895488, 25157456, 25834404, 27106634, 27399683, 27548147, 27553225, 29498756, 29699061, 29850615, 30248539, 30333178, 30374881, 30536538, 30628687, 30967632, 31415355, 31432701, 31501466, 31526290, 31599069, 31793207, 31849975, 31867004, 32121588, 32377698, 32387680, 32388272, 32630231, 33043579, 33274236, 33485352, 33859775, 34034759, 34424286, 34553218, 34922604, 35216073, 35628361, 35700822, 35908771, 36152754, 36184551, 36263320, 36326096, 36547913, 37637169, 37649486, 38227801
Inflammation	Stimulate	27922090
Inflammatory Bowel Diseases	Associate	35908771
Inflammatory Breast Neoplasms	Associate	40468448
Insulin Resistance	Associate	12902351, 18263705, 20888662, 22351776, 23651848, 26800561, 33274236, 34034759, 37898813
Insulin Resistance	Stimulate	17986714, 23975543, 27688298
Insulinoma	Associate	16869889
Intervertebral Disc Degeneration	Associate	25304312
Intracranial Aneurysm	Associate	18239167
Ischemia	Stimulate	22761181, 25583406
Kashin Beck Disease	Stimulate	23866832
Kidney Calculi	Associate	35016690
Kidney Diseases	Associate	11849444, 34962918
Kidney Diseases Cystic	Associate	34962918
Kidney Neoplasms	Associate	19681889, 26573018
Kimura Disease	Stimulate	25905460
Laryngeal Neoplasms	Associate	26001828
Leukemia	Associate	15171819, 15494423, 15964800, 17352239, 21702955, 21887305, 25526629, 25791120, 26472107, 26985944, 33919224, 8524841
Leukemia Biphenotypic Acute	Associate	34257610
Leukemia Lymphocytic Chronic B Cell	Associate	15540985, 20628148, 26891146, 26985944, 28982149
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	16982329, 19363496, 21887305, 23370352, 25619392, 36195570
Leukemia Myeloid	Associate	17583492, 19339050, 25321472, 25619389
Leukemia Myeloid Acute	Associate	11698483, 16982329, 20945381, 26043758, 33561558, 35840666
Leukemia Myeloid Acute	Inhibit	37960824
Leukemia Myelomonocytic Chronic	Associate	22328940
Leukemia Prolymphocytic T Cell	Associate	19737143, 25753324
Leukemia Promyelocytic Acute	Associate	15637062
Liver Cirrhosis Biliary	Associate	13130464, 16802349, 32131874
Liver Cirrhosis Biliary	Stimulate	21953337
Liver Diseases	Associate	21272161
Liver Failure	Associate	25080058
Liver Neoplasms	Associate	37542825
Lung Diseases	Associate	32457348
Lung Neoplasms	Associate	12714585, 14965369, 21525012, 22222766, 23681803, 24505400, 26362062, 26560124, 28251885, 28592245, 28618937, 29132432, 30875659, 32277638, 32358059, 33313952, 33360044, 35850313, 36224313
Lung Neoplasms	Inhibit	15705594
Lupus Erythematosus Systemic	Associate	22966240, 24495300, 26090483
Lymphoma	Associate	11106658, 12502848, 19937141, 24915933
Lymphoma B Cell	Associate	19270531
Lymphoma Large Cell Anaplastic	Associate	17416736
Lymphoma Non Hodgkin	Associate	25070240
Lymphoma T Cell Cutaneous	Associate	30194255
Majeed syndrome	Associate	33314777
Malformations of Cortical Development Group I	Associate	10737620, 14617628, 18045590, 18234997, 32787872
Malformations of Cortical Development Group I	Stimulate	30262777
Mammary Neoplasms Animal	Associate	27045589
Mast Cell Activation Disorders	Associate	16923120
Melanoma	Associate	16951673, 17304627, 17482134, 22832488, 25137374, 25793618, 25814555, 26808375, 28703746, 32134466, 33430068, 35307409, 36293123, 36982528, 37277447
Melanoma Experimental	Associate	12684272
Melanosis	Associate	30559147
Mesenteric Ischemia	Associate	24346217
Mesothelioma	Associate	12707267, 22076560
Mesothelioma Malignant	Associate	15830375
Metabolic Diseases	Associate	26800561
Metabolic Syndrome	Associate	21266669
Mitochondrial Diseases	Associate	15782127, 16141349, 18373696, 19245689, 19270531, 20338993, 26083398, 30374881, 30656603, 32554853, 33097606, 33763168, 34895315, 35342363, 36122664
Mouth Neoplasms	Associate	25233933, 32502840, 33921647
Multiple Myeloma	Associate	12393500, 12665525, 17032922, 17255354, 17384201, 22276160, 23045269, 26689580, 26724804, 33658484, 36251145, 36289430
Multiple Sclerosis	Associate	10550297
Myelodysplastic Syndromes	Associate	22559819, 25472472
Myocardial Infarction	Associate	19843577, 29197221
Myopathy with Giant Abnormal Mitochondria	Associate	27023913
Nasopharyngeal Carcinoma	Associate	20637487, 21943220, 22727408, 24157866, 25028967, 27859422, 29738439, 31691433, 32196600, 34165177
Nasopharyngeal Neoplasms	Associate	18789327
Necrosis	Associate	22421439
Neoplasm Metastasis	Associate	16450001, 16951673, 22832488, 25053598, 26433471, 26718209, 26808375, 27895401, 28482915, 28591712, 28869833, 29138007, 33402468, 35955737, 36054930, 36200182
Neoplasm Metastasis	Inhibit	37310848
Neoplasms	Associate	10212278, 11038347, 11326313, 12018840, 12149148, 14766760, 15496400, 15637069, 15851011, 16002723, 16450001, 17643099, 18940813, 19106640, 19223550, 19414586, 19634160, 19806201, 20093361, 20338993, 20368806, 21148313, 21734453, 22727408, 23051914, 23319048, 23638624, 24118792, 24358224, 24434780, 24733045, 24782645, 24820097, 25053598, 25175743, 25187486, 25198898, 25254241, 25383959, 25526030, 25596741, 25619840, 26095609, 26235742, 26918450, 27034261, 27045589, 27203743, 27268017, 27697617, 27895401, 28368408, 28457938, 28482915, 28591712, 28656265, 28869833, 29321004, 29368981, 29572137, 29666306, 30305612, 30523245, 30850583, 32260423, 32293395, 32442913, 32601196, 34045311, 34257610, 34712959, 34921996, 34962918, 35292636, 35361778, 35794816, 35855804, 35955737, 36100939, 36158891, 36232313, 36543245, 36867694, 37814317, 37960824, 38030062, 39940976, 40280416, 40594834, 9724739
Neoplasms	Stimulate	10807930, 15119004, 18986987, 19041150, 29728125
Neoplasms	Inhibit	18313383, 27362798
Neoplasms Adipose Tissue	Stimulate	27688298
Neoplasms Adipose Tissue	Associate	29229927, 36184551
Neoplasms Glandular and Epithelial	Associate	16489115
Neoplasms Squamous Cell	Associate	23633919
Nephrolithiasis Calcium Oxalate	Associate	37191760
Nephrotic Syndrome	Associate	23871663, 34873575
Nerve Degeneration	Associate	12058026, 15993333, 24349175
Nervous System Diseases	Associate	18242171
Neuroblastoma	Associate	14617628, 15993333, 24253178, 26592517, 27732954
Neurodegenerative Diseases	Associate	28366453, 34962918
Neurofibromatosis 2	Associate	16643666
Neuroinflammatory Diseases	Associate	19162185, 20631174, 33834930
Neuroma Acoustic	Associate	21697181, 23728448
Neuronal Ceroid Lipofuscinoses	Associate	30621751
Neuronal intestinal pseudoobstruction	Associate	12580546
Non alcoholic Fatty Liver Disease	Associate	24885871
Non alcoholic Fatty Liver Disease	Stimulate	34198988
Noonan Syndrome	Associate	32514133
Obesity	Associate	12902351, 22351776, 23110196, 24895488, 27688298
Obesity	Stimulate	23975543, 24484739, 25370852, 27481183
Obesity Maternal	Associate	30006153
Oral Submucous Fibrosis	Associate	24035571
Ossification of Posterior Longitudinal Ligament	Associate	17702747
Osteoarthritis	Associate	12507586, 19302240, 21172926, 21194467, 25091567, 26982743, 32377698, 33097606, 37507717
Osteoarthritis Knee	Stimulate	21538317
Osteogenesis Imperfecta	Associate	33850461
Osteogenesis imperfecta type 1A	Associate	18239167
Osteoglophonic dwarfism	Stimulate	25635827, 31251836
Osteoporosis	Associate	36626454
Osteoporotic Fractures	Associate	28349059
Osteosarcoma	Associate	17218775, 17412493, 24025361, 27035222, 27144433, 28244849, 29523223, 30142914, 31505816, 33239866, 36438897
Otitis	Associate	28124644
Ovarian Neoplasms	Associate	10075725, 10531373, 12183452, 12637505, 12785726, 22761939, 22900074, 24602453, 24865582, 25891642, 26261528, 26433471, 28423586, 31770410, 32021086, 35251480, 36122664, 36766725, 37400764
Overweight	Stimulate	27481183
Pancreatic Neoplasms	Associate	18094619, 19194824, 24512202, 30584464, 31652886, 33098056, 33341545, 34782370, 35383226, 36990335
Pancreatic Neoplasms	Stimulate	25473894
Parkinson Disease	Associate	16515547, 28365714, 33253821, 36501032
Periodontitis	Associate	31599069
Platelet Disorder Familial with Associated Myeloid Malignancy	Associate	33569577
Pneumonia	Associate	27010141
Polycystic Kidney Autosomal Dominant	Associate	34962918
Polycystic Kidney Diseases	Associate	34962918
Pre Eclampsia	Associate	29949134
Precancerous Conditions	Stimulate	24434654, 37530327
Precancerous Conditions	Associate	31180559
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	17054427, 18322253, 20701602, 25526629, 28603286, 34519588, 35805156
Primary Myelofibrosis	Associate	35439167
Prostatic Neoplasms	Associate	10839298, 12663665, 14766760, 18472959, 19420015, 19667069, 20566643, 20649571, 21734453, 23380421, 24980815, 25559363, 25971429, 31600936, 31902674, 32319589, 32427575, 34099634, 36364008, 38099475
Prostatic Neoplasms	Stimulate	12902351
Prostatic Neoplasms	Inhibit	19275204
Prostatic Neoplasms Castration Resistant	Associate	29460131, 38099475
Prostatitis	Associate	14766760, 16238095, 17534446, 19147541, 34269000
Psoriasis	Associate	30171832
Psychological Distress	Associate	26090483
Pulmonary Arterial Hypertension	Associate	25905460
Pulmonary Disease Chronic Obstructive	Associate	22518834, 24988221, 30468094
Rectal Neoplasms	Associate	23027623, 29241219
Rectal Neoplasms	Stimulate	37960824
Renal Insufficiency Chronic	Associate	21228768, 33043579
Reperfusion Injury	Associate	19596001
Reperfusion Injury	Stimulate	34694031
Respiratory Distress Syndrome	Associate	31531373
Ring Chromosome 20 Syndrome	Stimulate	31251836
Rupture	Associate	18239167
Sarcoma	Associate	16619517, 16705697
Sarcoma Ewing	Associate	15581626
Sarcoma Kaposi	Associate	16699017, 17964626
Sarcoma Synovial	Associate	26850593
Scleroderma Systemic	Stimulate	24578173, 30157947
Senior Loken Syndrome	Associate	11849444
Sialadenitis	Associate	10340964
Sjogren's Syndrome	Associate	10340964, 37408182
Small Cell Lung Carcinoma	Associate	12149148, 9092556
Small Cell Lung Carcinoma	Stimulate	15173070
Smooth Muscle Tumor	Associate	17468136
Spastic Paraplegia Hereditary	Stimulate	16388335
Spastic Paraplegia Hereditary	Associate	33602173
Spinal Dysraphism	Associate	31898828
Spinocerebellar Ataxia 11	Associate	25062847
Spinocerebellar Ataxias	Associate	25062847
Squamous Cell Carcinoma of Head and Neck	Associate	24205072, 24398980, 24497297, 27930712, 32085431, 34553218, 35974187, 36430348, 38030062
Status Asthmaticus	Associate	22387292, 27013170
Stomach Diseases	Associate	22905237
Stomach Neoplasms	Associate	12439916, 15069708, 18356158, 20150185, 20559021, 22905237, 23326144, 23921907, 25198898, 25243868, 25342459, 26291058, 26645893, 27268017, 27431278, 27895401, 29343514, 29666306, 31466817, 31829409, 32390606, 35748914
Striae Distensae	Stimulate	28784087
Sturge Weber Syndrome	Associate	33707187
Supranuclear Palsy Progressive	Associate	35976433
Systemic Inflammatory Response Syndrome	Associate	24346217, 32329660
Takayasu Arteritis	Stimulate	40243489
Thyroid Cancer Papillary	Associate	15119004
Thyroid Neoplasms	Associate	21333695, 28099584, 28709407, 28730778, 31180559, 37932340
Tongue Neoplasms	Associate	30656603
Tooth Loss	Associate	27023913
Triple Negative Breast Neoplasms	Associate	24642040, 30442712, 32985606, 35053370, 36969705
Tuberculosis Multidrug Resistant	Associate	22870247
Tuberous Sclerosis	Associate	24988221
Urethral Neoplasms	Associate	24349176
Urinary Bladder Neoplasms	Associate	23922701, 25526030, 27171279, 27440446, 27556506, 36045117, 36543245
Urologic Diseases	Associate	21191629
Uterine Cervical Neoplasms	Associate	18373696, 19010820, 21928122, 22427461, 27034261, 29590661, 31081078, 31424656, 32521858, 34004082, 35191522, 35831303, 35939492
Uterine Cervical Neoplasms	Stimulate	33303976
Uterine Cervicitis	Stimulate	33303976
Uveal melanoma	Associate	36232829
Vascular Diseases	Associate	15734884, 27688298, 33763168, 33850461
Vascular Diseases	Stimulate	26800561
Vascular System Injuries	Associate	28546532, 30536538
Venous Insufficiency	Associate	33850461
WHIM syndrome	Associate	33485325
Wounds and Injuries	Associate	24346217, 27431384, 30046375, 31312872, 33293495
Zellweger Syndrome	Stimulate	37974207