Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5599
Gene name Gene Name - the full gene name approved by the HGNC.	Mitogen-activated protein kinase 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MAPK8
Synonyms (NCBI Gene) Gene synonyms aliases	JNK, JNK-46, JNK1, JNK1A2, JNK21B1/2, PRKM8, SAPK1, SAPK1c
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q11.22
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription

Show/Hide all(168)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003985	hsa-miR-199a-3p	Western blot	18456660
MIRT005427	hsa-miR-214-3p	GFP reporter assay, Microarray, qRT-PCR, Western blot	19859982
MIRT005427	hsa-miR-214-3p	GFP reporter assay, Microarray, qRT-PCR, Western blot	19859982
MIRT016104	hsa-miR-421	Sequencing	20371350
MIRT016510	hsa-miR-193b-3p	Microarray	20304954
MIRT021289	hsa-miR-125a-5p	Sequencing	20371350
MIRT021678	hsa-miR-140-3p	Sequencing	20371350
MIRT005427	hsa-miR-214-3p	Reporter assay;qRT-PCR;Microarray;Other	19859982
MIRT025602	hsa-miR-10a-5p	Sequencing	20371350
MIRT028235	hsa-miR-33a-5p	Sequencing	20371350
MIRT016104	hsa-miR-421	CLASH	23622248
MIRT037323	hsa-miR-877-5p	CLASH	23622248
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT437964	hsa-miR-92a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24705900
MIRT566821	hsa-miR-4282	PAR-CLIP	20371350
MIRT473694	hsa-miR-497-3p	PAR-CLIP	20371350
MIRT536128	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT566820	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT566819	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT566818	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT566817	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT566816	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT566815	hsa-miR-548aw	PAR-CLIP	20371350
MIRT473699	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT473698	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT473697	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT473696	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT473695	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT473693	hsa-miR-193a-3p	PAR-CLIP	21572407
MIRT016510	hsa-miR-193b-3p	PAR-CLIP	21572407
MIRT473692	hsa-miR-892b	PAR-CLIP	21572407
MIRT473691	hsa-miR-4280	PAR-CLIP	21572407
MIRT473690	hsa-miR-3190-5p	PAR-CLIP	21572407
MIRT473689	hsa-miR-3926	PAR-CLIP	21572407
MIRT473688	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT473687	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT473686	hsa-miR-548s	PAR-CLIP	21572407
MIRT473685	hsa-miR-374b-3p	PAR-CLIP	21572407
MIRT441786	hsa-miR-3662	PAR-CLIP	22012620
MIRT441785	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT536130	hsa-miR-590-3p	PAR-CLIP	22012620
MIRT536129	hsa-miR-888-5p	PAR-CLIP	22012620
MIRT536128	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT536127	hsa-miR-371b-5p	PAR-CLIP	22012620
MIRT536126	hsa-miR-373-5p	PAR-CLIP	22012620
MIRT536125	hsa-miR-616-5p	PAR-CLIP	22012620
MIRT441784	hsa-miR-4480	PAR-CLIP	22012620
MIRT536124	hsa-miR-4775	PAR-CLIP	22012620
MIRT536123	hsa-miR-7703	PAR-CLIP	22012620
MIRT536122	hsa-miR-4325	PAR-CLIP	22012620
MIRT536121	hsa-miR-450b-5p	PAR-CLIP	22012620
MIRT536120	hsa-miR-507	PAR-CLIP	22012620
MIRT536119	hsa-miR-557	PAR-CLIP	22012620
MIRT501958	hsa-miR-3680-3p	PAR-CLIP	22012620
MIRT501966	hsa-miR-203a-3p	PAR-CLIP	24398324
MIRT501967	hsa-miR-33b-5p	PAR-CLIP	24398324
MIRT028235	hsa-miR-33a-5p	PAR-CLIP	24398324
MIRT501966	hsa-miR-203a-3p	PAR-CLIP	24398324
MIRT501965	hsa-miR-126-5p	PAR-CLIP	24398324
MIRT501964	hsa-miR-664a-3p	PAR-CLIP	24398324
MIRT501962	hsa-miR-8060	PAR-CLIP	24398324
MIRT501963	hsa-miR-496	PAR-CLIP	24398324
MIRT501961	hsa-miR-4795-3p	PAR-CLIP	24398324
MIRT501960	hsa-miR-7154-5p	PAR-CLIP	24398324
MIRT501959	hsa-miR-433-3p	PAR-CLIP	24398324
MIRT501958	hsa-miR-3680-3p	PAR-CLIP	24398324
MIRT473699	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT473698	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT473697	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT473696	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT473695	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT473694	hsa-miR-497-3p	PAR-CLIP	23592263
MIRT473693	hsa-miR-193a-3p	PAR-CLIP	23592263
MIRT016510	hsa-miR-193b-3p	PAR-CLIP	23592263
MIRT473692	hsa-miR-892b	PAR-CLIP	23592263
MIRT473691	hsa-miR-4280	PAR-CLIP	23592263
MIRT473690	hsa-miR-3190-5p	PAR-CLIP	23592263
MIRT473689	hsa-miR-3926	PAR-CLIP	23592263
MIRT473688	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT473687	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT473686	hsa-miR-548s	PAR-CLIP	23592263
MIRT473685	hsa-miR-374b-3p	PAR-CLIP	23592263
MIRT441786	hsa-miR-3662	PAR-CLIP	22100165
MIRT441785	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT441783	hsa-miR-3163	PAR-CLIP	22100165
MIRT441784	hsa-miR-4480	PAR-CLIP	22100165
MIRT736095	hsa-miR-141-3p	qRT-PCR	33133155
MIRT566821	hsa-miR-4282	PAR-CLIP	20371350
MIRT473694	hsa-miR-497-3p	PAR-CLIP	20371350
MIRT536128	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT566820	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT566819	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT566818	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT566817	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT566816	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT566815	hsa-miR-548aw	PAR-CLIP	20371350
MIRT473699	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT473698	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT473697	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT473696	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT473695	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT473693	hsa-miR-193a-3p	PAR-CLIP	21572407
MIRT016510	hsa-miR-193b-3p	PAR-CLIP	21572407
MIRT473692	hsa-miR-892b	PAR-CLIP	21572407
MIRT473691	hsa-miR-4280	PAR-CLIP	21572407
MIRT473690	hsa-miR-3190-5p	PAR-CLIP	21572407
MIRT473689	hsa-miR-3926	PAR-CLIP	21572407
MIRT473688	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT473687	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT473686	hsa-miR-548s	PAR-CLIP	21572407
MIRT473685	hsa-miR-374b-3p	PAR-CLIP	21572407
MIRT441786	hsa-miR-3662	PAR-CLIP	22012620
MIRT441785	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT536130	hsa-miR-590-3p	PAR-CLIP	22012620
MIRT536129	hsa-miR-888-5p	PAR-CLIP	22012620
MIRT536128	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT536127	hsa-miR-371b-5p	PAR-CLIP	22012620
MIRT536126	hsa-miR-373-5p	PAR-CLIP	22012620
MIRT536125	hsa-miR-616-5p	PAR-CLIP	22012620
MIRT441784	hsa-miR-4480	PAR-CLIP	22012620
MIRT536124	hsa-miR-4775	PAR-CLIP	22012620
MIRT536123	hsa-miR-7703	PAR-CLIP	22012620
MIRT536122	hsa-miR-4325	PAR-CLIP	22012620
MIRT536121	hsa-miR-450b-5p	PAR-CLIP	22012620
MIRT536120	hsa-miR-507	PAR-CLIP	22012620
MIRT536119	hsa-miR-557	PAR-CLIP	22012620
MIRT501958	hsa-miR-3680-3p	PAR-CLIP	22012620
MIRT501966	hsa-miR-203a-3p	PAR-CLIP	24398324
MIRT501967	hsa-miR-33b-5p	PAR-CLIP	24398324
MIRT028235	hsa-miR-33a-5p	PAR-CLIP	24398324
MIRT501966	hsa-miR-203a-3p	PAR-CLIP	24398324
MIRT501965	hsa-miR-126-5p	PAR-CLIP	24398324
MIRT501964	hsa-miR-664a-3p	PAR-CLIP	24398324
MIRT501962	hsa-miR-8060	PAR-CLIP	24398324
MIRT501963	hsa-miR-496	PAR-CLIP	24398324
MIRT501961	hsa-miR-4795-3p	PAR-CLIP	24398324
MIRT501960	hsa-miR-7154-5p	PAR-CLIP	24398324
MIRT501959	hsa-miR-433-3p	PAR-CLIP	24398324
MIRT501958	hsa-miR-3680-3p	PAR-CLIP	24398324
MIRT473699	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT473698	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT473697	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT473696	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT473695	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT473694	hsa-miR-497-3p	PAR-CLIP	23592263
MIRT473693	hsa-miR-193a-3p	PAR-CLIP	23592263
MIRT016510	hsa-miR-193b-3p	PAR-CLIP	23592263
MIRT473692	hsa-miR-892b	PAR-CLIP	23592263
MIRT473691	hsa-miR-4280	PAR-CLIP	23592263
MIRT473690	hsa-miR-3190-5p	PAR-CLIP	23592263
MIRT473689	hsa-miR-3926	PAR-CLIP	23592263
MIRT473688	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT473687	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT473686	hsa-miR-548s	PAR-CLIP	23592263
MIRT473685	hsa-miR-374b-3p	PAR-CLIP	23592263
MIRT441786	hsa-miR-3662	PAR-CLIP	22100165
MIRT441785	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT441783	hsa-miR-3163	PAR-CLIP	22100165
MIRT441784	hsa-miR-4480	PAR-CLIP	22100165
MIRT473699	hsa-miR-30a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35001794
MIRT2037380	hsa-miR-1244	CLIP-seq
MIRT2037381	hsa-miR-3168	CLIP-seq

Transcription factors

Show/Hide all(5)

Transcription factor	Regulation	Reference
E2F1	Unknown	20800677
E2F3	Unknown	20800677
HSF2	Repression	11557063
JUN	Activation	19324081
JUN	Unknown	16397260

Show/Hide all(78)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IDA	15850461
GO:0000165	Process	MAPK cascade	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	14967141, 15850461, 20027304, 21095239, 22966201, 27568560, 28943315, 34048572
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004705	Function	JUN kinase activity	IBA
GO:0004705	Function	JUN kinase activity	IDA	8654373, 21095239
GO:0004705	Function	JUN kinase activity	ISS
GO:0004705	Function	JUN kinase activity	TAS
GO:0004707	Function	MAP kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	10393177, 10490659, 10747973, 10856240, 11517249, 15334056, 15894542, 16291755, 16533805, 16840345, 16982329, 18003900, 18286207, 19234442, 19527717, 21900206, 22966201, 23602568, 25284480, 27043084, 27880917, 32296183, 32707033, 33961781, 35271311, 36935496
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	20027304, 30878395
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006302	Process	Double-strand break repair	IDA	27568560, 28190768, 32028527
GO:0006468	Process	Protein phosphorylation	IMP	22441692
GO:0006979	Process	Response to oxidative stress	IDA	22966201
GO:0007254	Process	JNK cascade	IBA
GO:0007254	Process	JNK cascade	IDA	8654373
GO:0007258	Process	JUN phosphorylation	IDA	14967141
GO:0007258	Process	JUN phosphorylation	IDA	21095239
GO:0009411	Process	Response to UV	IDA	14967141
GO:0009612	Process	Response to mechanical stimulus	IBA
GO:0010628	Process	Positive regulation of gene expression	IMP	22065586
GO:0016241	Process	Regulation of macroautophagy	TAS	26546165
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	21095239, 22966201
GO:0018107	Process	Peptidyl-threonine phosphorylation	IDA	21095239
GO:0019899	Function	Enzyme binding	IPI	14615289
GO:0019903	Function	Protein phosphatase binding	IPI	11489891
GO:0030424	Component	Axon	ISS	22683681
GO:0031281	Process	Positive regulation of cyclase activity	IMP	22027397
GO:0031343	Process	Positive regulation of cell killing	TAS
GO:0032091	Process	Negative regulation of protein binding	IDA	21095239
GO:0032880	Process	Regulation of protein localization	IDA	20027304
GO:0034198	Process	Cellular response to amino acid starvation	IDA	11096076
GO:0034599	Process	Cellular response to oxidative stress	IDA	27568560
GO:0034614	Process	Cellular response to reactive oxygen species	IDA	34048572
GO:0035033	Function	Histone deacetylase regulator activity	IMP	20027304
GO:0038095	Process	Fc-epsilon receptor signaling pathway	IEA
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0042826	Function	Histone deacetylase binding	IPI	20027304
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	TAS
GO:0043066	Process	Negative regulation of apoptotic process	IDA	14967141
GO:0043066	Process	Negative regulation of apoptotic process	IDA	21095239
GO:0043488	Process	Regulation of mRNA stability	IDA	34048572
GO:0044546	Process	NLRP3 inflammasome complex assembly	IDA	35114687, 35254907
GO:0045202	Component	Synapse	IEA
GO:0045202	Component	Synapse	ISS
GO:0048511	Process	Rhythmic process	IEA
GO:0051247	Process	Positive regulation of protein metabolic process	IMP	22027397
GO:0051403	Process	Stress-activated MAPK cascade	IDA	11096076
GO:0061157	Process	MRNA destabilization	IDA	34048572
GO:0070212	Process	Protein poly-ADP-ribosylation	IDA	28190768
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	23776175
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0090398	Process	Cellular senescence	IEA
GO:0090398	Process	Cellular senescence	TAS
GO:0097009	Process	Energy homeostasis	ISS
GO:0097009	Process	Energy homeostasis	ISS
GO:0097441	Component	Basal dendrite	ISS	22683681
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0120283	Function	Protein serine/threonine kinase binding	IPI	11865055
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	IDA	28943315
GO:1903749	Process	Positive regulation of establishment of protein localization to mitochondrion	TAS
GO:1990166	Process	Protein localization to site of double-strand break	IDA	27568560

MIM	HGNC	e!Ensembl
601158	6881	ENSG00000107643

Protein

UniProt ID

P45983

Protein name

Mitogen-activated protein kinase 8 (MAP kinase 8) (MAPK 8) (EC 2.7.11.24) (JNK-46) (Stress-activated protein kinase 1c) (SAPK1c) (Stress-activated protein kinase JNK1) (c-Jun N-terminal kinase 1)

Protein function

Serine/threonine-protein kinase involved in various processes such as cell proliferation, differentiation, migration, transformation and programmed cell death. Extracellular stimuli such as pro-inflammatory cytokines or physical stress stimulate

PDB

1UKH , 1UKI , 2G01 , 2GMX , 2H96 , 2NO3 , 2XRW , 2XS0 , 3ELJ , 3O17 , 3O2M , 3PZE , 3V3V , 3VUD , 3VUG , 3VUH , 3VUI , 3VUK , 3VUL , 3VUM , 4AWI , 4E73 , 4G1W , 4HYS , 4HYU , 4IZY , 4L7F , 4QTD , 4UX9 , 4YR8 , 5LW1 , 6F5E , 6ZR5 , 8PT8 , 8PT9 , 8PTA , 8R5E , 8X5M , 9FT9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	26 → 321	Protein kinase domain	Domain

Sequence

MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAA
GPLGCCR

Sequence length

427

Interactions

View interactions

	KEGG		Reactome
	Endocrine resistance MAPK signaling pathway ErbB signaling pathway Ras signaling pathway cAMP signaling pathway FoxO signaling pathway Sphingolipid signaling pathway Mitophagy - animal Autophagy - animal Protein processing in endoplasmic reticulum Apoptosis Apoptosis - multiple species Necroptosis Wnt signaling pathway Osteoclast differentiation Focal adhesion Tight junction Toll-like receptor signaling pathway NOD-like receptor signaling pathway RIG-I-like receptor signaling pathway C-type lectin receptor signaling pathway IL-17 signaling pathway Th1 and Th2 cell differentiation Th17 cell differentiation T cell receptor signaling pathway Fc epsilon RI signaling pathway TNF signaling pathway Neurotrophin signaling pathway Retrograde endocannabinoid signaling Dopaminergic synapse Inflammatory mediator regulation of TRP channels Insulin signaling pathway GnRH signaling pathway Progesterone-mediated oocyte maturation Prolactin signaling pathway Adipocytokine signaling pathway Relaxin signaling pathway Type II diabetes mellitus Insulin resistance Non-alcoholic fatty liver disease AGE-RAGE signaling pathway in diabetic complications Growth hormone synthesis, secretion and action Alcoholic liver disease Alzheimer disease Parkinson disease Huntington disease Spinocerebellar ataxia Prion disease Pathways of neurodegeneration - multiple diseases Epithelial cell signaling in Helicobacter pylori infection Pathogenic Escherichia coli infection Shigellosis Salmonella infection Pertussis Yersinia infection Chagas disease Toxoplasmosis Tuberculosis Hepatitis B Measles Human T-cell leukemia virus 1 infection Kaposi sarcoma-associated herpesvirus infection Epstein-Barr virus infection Human immunodeficiency virus 1 infection Coronavirus disease - COVID-19 Pathways in cancer Chemical carcinogenesis - reactive oxygen species Colorectal cancer Pancreatic cancer Choline metabolism in cancer Diabetic cardiomyopathy Lipid and atherosclerosis Fluid shear stress and atherosclerosis		Activation of BIM and translocation to mitochondria Activation of BMF and translocation to mitochondria NRAGE signals death through JNK Oxidative Stress Induced Senescence FCERI mediated MAPK activation DSCAM interactions JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1 Activation of the AP-1 family of transcription factors Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks Interleukin-38 signaling WNT5:FZD7-mediated leishmania damping

MAPK8 (mitogen-activated protein kinase 8)