MAPK7 (mitogen-activated protein kinase 7)

Gene
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5598
Gene name Gene Name - the full gene name approved by the HGNC.
Mitogen-activated protein kinase 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MAPK7
Synonyms (NCBI Gene) Gene synonyms aliases
BMK1, ERK4, ERK5, PRKM7
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription
SNPs SNP information provided by dbSNP.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(3)
SNP ID Visualize variation Clinical significance Consequence
rs147296805 G>A,T Pathogenic Missense variant, coding sequence variant
rs758163506 C>T Pathogenic Coding sequence variant, missense variant
rs1555613564 C>T Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(49)
miRTarBase ID miRNA Experiments Reference
MIRT003759 hsa-miR-143-3p Western blot 19464056
MIRT003759 hsa-miR-143-3p Luciferase reporter assay 19464056
MIRT003759 hsa-miR-143-3p Luciferase reporter assay, Western blot 19855844
MIRT003759 hsa-miR-143-3p Luciferase reporter assay 19464056
MIRT003759 hsa-miR-143-3p Review 20144549
Transcription factors
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(2)
Transcription factor Regulation Reference
MEF2A Activation 18073218
MEF2C Activation 11158308
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(53)
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade ISS
GO:0000166 Function Nucleotide binding IEA
GO:0004672 Function Protein kinase activity IEA
GO:0004674 Function Protein serine/threonine kinase activity IBA
GO:0004674 Function Protein serine/threonine kinase activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
602521 6880 ENSG00000166484
Protein
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q13164
Protein name Mitogen-activated protein kinase 7 (MAP kinase 7) (MAPK 7) (EC 2.7.11.24) (Big MAP kinase 1) (BMK-1) (Extracellular signal-regulated kinase 5) (ERK-5)
Protein function Plays a role in various cellular processes such as proliferation, differentiation and cell survival. The upstream activator of MAPK7 is the MAPK kinase MAP2K5. Upon activation, it translocates to the nucleus and phosphorylates various downstream
PDB 2Q8Y , 4B99 , 4IC7 , 4IC8 , 4ZSG , 4ZSJ , 4ZSL , 5BYY , 5BYZ , 5O7I , 6HKM , 6HKN , 7PUS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 55 → 347 Protein kinase domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in many adult tissues. Abundant in heart, placenta, lung, kidney and skeletal muscle. Not detectable in liver. {ECO:0000269|PubMed:7759517}.
Sequence 
MAEPLKEEDGEDGSAEPPGPVKAEPAHTAASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMP
SPWAPSGDCAMESPPPAPPPCPGPAPDTIDLTLQPPPPVSEPAPPKKDGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGASGGPSTDPLAGLVLSDNDRSLLERWTRMARPAAPALTSVPAPAPAPTPTPTPV
QPTSPPPGPVAQPTGPQPQSAGSTSGPVPQPACPPPGPAPHPTGPPGPIPVPAPPQIATS
TSLLAAQSLVPPPGLPGSSTPGVLPYFPPGLPPPDAGGAPQSSMSESPDVNLVTQQLSKS
QVEDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLAD
WLEGHGMNPADIESLQREIQMDSPMLLADLPDLQDP
Sequence length 816
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  MAPK signaling pathway
Gap junction
IL-17 signaling pathway
Neurotrophin signaling pathway
GnRH signaling pathway
Oxytocin signaling pathway
MicroRNAs in cancer
Fluid shear stress and atherosclerosis 		  ERK/MAPK targets
Signalling to ERK5
ERKs are inactivated
Senescence-Associated Secretory Phenotype (SASP)
Gastrin-CREB signalling pathway via PKC and MAPK
RET signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Scoliosis Scoliosis, isolated, susceptibility to, 1 rs1555613564, rs147296805, rs758163506 N/A
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Heart Failure Heart failure N/A N/A GWAS
Lung Cancer Non-small cell lung cancer Finally, genetic knockdown of MAPK7 combined with the MEK inhibitor cobimetinib in a mutant KRAS NSCLC xenograft model to mediate improved tumor growth inhibition. 29912950 CBGDA
Show/Hide Text Mining Associations (52)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Autism Spectrum Disorder Associate 31838722
Autistic Disorder Associate 21848643
Breast Neoplasms Associate 11739740, 19087274, 24505128, 28746466, 31424663, 35348268, 35609325
Cap Myopathy Associate 23321517
Carcinogenesis Associate 26040563, 39972514
Carcinoma Hepatocellular Stimulate 12679910
Carcinoma Hepatocellular Associate 32521892, 36650140
Carcinoma Non Small Cell Lung Associate 16835228, 26040563
Carcinoma Renal Cell Associate 27836247, 35955582
Carcinoma Squamous Cell Associate 26040563