Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55906
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger C4H2-type containing
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZC4H2
Synonyms (NCBI Gene) Gene synonyms aliases
HCA127, KIAA1166, MCS, MRXS4, WRWF, WRWFFR, WWS
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq11.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the zinc finger domain-containing protein family. This family member has a C-terminal zinc finger domain that is characterized by four cysteine residues and two histidine residues, and it also includes a coiled-coil region. T
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs137962226 G>A,T Benign, pathogenic, likely-pathogenic Coding sequence variant, non coding transcript variant, synonymous variant, missense variant
rs398122938 C>G Pathogenic Non coding transcript variant, missense variant, coding sequence variant
rs398122939 G>A Pathogenic Non coding transcript variant, synonymous variant, missense variant, coding sequence variant
rs750367160 TTC>- Pathogenic Coding sequence variant, non coding transcript variant, inframe deletion
rs797044863 G>A Pathogenic Stop gained, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT442883 hsa-miR-218-2-3p PAR-CLIP 22100165
MIRT442882 hsa-miR-4539 PAR-CLIP 22100165
MIRT442881 hsa-miR-182-3p PAR-CLIP 22100165
MIRT442880 hsa-miR-597-3p PAR-CLIP 22100165
MIRT442879 hsa-miR-152-5p PAR-CLIP 22100165
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003358 Process Noradrenergic neuron development IEA
GO:0005515 Function Protein binding IPI 16189514, 25416956, 26871637, 30177510, 31515488, 32296183, 33961781
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 23623388, 26056227
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300897 24931 ENSG00000126970
Protein
UniProt ID Q9NQZ6
Protein name Zinc finger C4H2 domain-containing protein (Hepatocellular carcinoma-associated antigen 127)
Protein function Plays a role in interneurons differentiation (PubMed:26056227). Involved in neuronal development and in neuromuscular junction formation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10146 zf-C4H2 13 147 Zinc finger-containing protein Family
PF10146 zf-C4H2 138 221 Zinc finger-containing protein Family
Tissue specificity TISSUE SPECIFICITY: Expressed in fetal tissues, including in brain, intestine, lung, kidney and muscle (PubMed:23623388). Isoform 1 is expressed in numerous fetal brain regions. Isoform 3 is highly expressed in numerous fetal brain regions and spinal cord
Sequence
MADEQEIMCKLESIKEIRNKTLQMEKIKARLKAEFEALESEERHLKEYKQEMDLLLQEKM
AHVEELRLIHADINVMENTIKQSENDLNKLLESTRRLHDEYKPLKEHVDALRMTLGLQRL
PDLCEEEEKLSLDYFEK
QKAEWQTEPQEPPIPESLAAAAAAAQQLQVARKQDTRQTATFR
QQPPPMKACLSCHQQIHRNAPICPLCKAKSRSRNPKKPKRK
QDE
Sequence length 224
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Wieacker-Wolff Syndrome wieacker-wolff syndrome, Wieacker-Wolff syndrome, female-restricted rs1057520297, rs1602379828, rs1057520298, rs1929207873, rs1057520299, rs1929135614, rs1064795753, rs1929002470, rs1131691616, rs1929070198, rs1929216641, rs398122938, rs137962226, rs879255235, rs1555933616
View all (5 more)
N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Hypogonadism Hypogonadism N/A N/A GWAS
Mental retardation X-linked syndromic intellectual disability N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthrogryposis Associate 33949289
Demyelinating Diseases Associate 33949289
Duane Retraction Syndrome Associate 33949289
Marcus Gunn phenomenon Associate 33949289
Mental Retardation X Linked Associate 21668950
Paraplegia Associate 38267061
Wieacker syndrome Associate 31885220, 33949289