Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55905
Gene name Gene Name - the full gene name approved by the HGNC.
Ring finger protein 114
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RNF114
Synonyms (NCBI Gene) Gene synonyms aliases
PSORS12, ZNF313
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q13.13
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT025727 hsa-miR-7-5p Microarray 19073608
MIRT1309423 hsa-miR-10a CLIP-seq
MIRT1309424 hsa-miR-10b CLIP-seq
MIRT1309425 hsa-miR-1184 CLIP-seq
MIRT1309426 hsa-miR-1193 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000209 Process Protein polyubiquitination IBA
GO:0005515 Function Protein binding IPI 19549727, 32296183, 32814053, 33961781
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612451 13094 ENSG00000124226
Protein
UniProt ID Q9Y508
Protein name E3 ubiquitin-protein ligase RNF114 (EC 2.3.2.27) (RING finger protein 114) (RING-type E3 ubiquitin transferase RNF114) (Zinc finger protein 228) (Zinc finger protein 313)
Protein function E3 ubiquitin-protein ligase that promotes the ubiquitination of various substrates (PubMed:23645206, PubMed:25165885). In turn, participates in the regulation of many biological processes including cell cycle, apoptosis, osteoclastogenesis as we
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13445 zf-RING_UBOX 29 71 RING-type zinc-finger Domain
PF18574 zf_C2HC_14 85 117 C2HC Zing finger domain Domain
PF05605 zf-Di19 139 200 Drought induced 19 protein (Di19), zinc-binding Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in numerous tissues, including skin, CD4 lymphocytes and dendritic cells. Highest levels in testis. {ECO:0000269|PubMed:18364390}.
Sequence
MAAQQRDCGGAAQLAGPAAEADPLGRFTCPVCLEVYEKPVQVPCGHVFCSACLQECLKPK
KPVCGVCRSAL
APGVRAVELERQIESTETSCHGCRKNFFLSKIRSHVATCSKYQNYIMEG
VKATIKDASLQPRNVPNRYTFPCPYCPEKNFDQEGLVEHCKLFHSTDTKSVVCPICASMP
WGDPNYRSANFREHIQRRHR
FSYDTFVDYDVDEEDMMNQVLQRSIIDQ
Sequence length 228
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Antigen processing: Ubiquitination & Proteasome degradation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coronary artery disease Coronary artery disease N/A N/A GWAS
Psoriasis Psoriasis N/A N/A GWAS
Psoriasis vulgaris Psoriasis vulgaris N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Psoriatic Associate 21623003
Breast Neoplasms Associate 37878693
Frontotemporal Dementia Associate 37979250
Lupus Erythematosus Systemic Associate 24871463
Mouth Neoplasms Associate 36142544
Neoplasms Associate 28600258, 37878693
Psoriasis Associate 20953189