Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55900
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger protein 302
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZNF302
Synonyms (NCBI Gene) Gene synonyms aliases
HSD16, MST154, MSTP154, ZNF135L, ZNF140L, ZNF327
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.11
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the zinc-finger protein family. The encoded protein contains seven C2H2-type zinc fingers and a KRAB domain, but its function has yet to be determined. Alternatively spliced transcript variants have been described. [provided
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003826 hsa-miR-197-3p Microarray 16822819
MIRT1521621 hsa-miR-1206 CLIP-seq
MIRT1521622 hsa-miR-1252 CLIP-seq
MIRT1521623 hsa-miR-1260 CLIP-seq
MIRT1521624 hsa-miR-1260b CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0005515 Function Protein binding IPI 25416956, 31515488
GO:0005634 Component Nucleus IBA 21873635
GO:0006357 Process Regulation of transcription by RNA polymerase II IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
621271 13848 ENSG00000089335
Protein
UniProt ID Q9NR11
Protein name Zinc finger protein 302 (Zinc finger protein 135-like) (Zinc finger protein 140-like) (Zinc finger protein 327)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 3 44 KRAB box Family
PF00096 zf-C2H2 280 302 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 308 330 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 336 358 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 364 386 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 392 414 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 420 442 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 448 470 Zinc finger, C2H2 type Domain
Sequence
MSQVTFSDVAIDFSHEEWACLDSAQRDLYKDVMVQNYENLVSVGLSVTKPYVIMLLEDGK
EPWMMEKKLSKAYPFPLSHSVPASVNFGFSALFEHCSEVTEIFELSELCVFWVLHFLSNS
PNSTVEAFSRSKKKKKKKKKRQCFAFLIYFRLGIKMGKQGIINKEGYLYEDSPQPVTMEK
VVKQSYEFSNSNKNLEYTECDTFRSTFHSKSTLSEPQNNSAEGNSHKYDILKKNLSKKSV
IKSERINGGKKLLNSNKSGAAFNQSKSLTLPQTCNREKIYTCSECGKAFGKQSILSRHWR
IH
TGEKPYECRECGKTFSHGSSLTRHQISHSGEKPYKCIECGKAFSHGSSLTNHQSTHTG
EKPYECMNCGKSFSRVSLLIQHLRIHTQEKRYECRICGKAFIHSSSLIHHQKSHTGEKPY
ECRECGKAFCCSSHLTQHQRIH
SMKKKYECNKCLKVFSSFSFLVQHQSIHTEEKPFEV
Sequence length 478
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Generic Transcription Pathway
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Rheumatoid arthritis Rheumatoid Arthritis rs587776843 21452313
Associations from Text Mining
Disease Name Relationship Type References
Chromosome 19q13.11 Deletion Syndrome Associate 22378287