LENEP (lens epithelial protein)

Gene

• Entrez ID: 55891
• Gene name: Lens epithelial protein
• Gene symbol: LENEP
• Synonyms (NCBI Gene): LEP503
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: The ocular lens is a tissue of epithelial origin and devoid of blood vessels and nerves. Cells of the lens epithelium are responsible for the growth and maintenance of the lens through mitosis, protein synthesis, and active transport of ions and metabolit

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1107396	hsa-miR-138	CLIP-seq
MIRT1107397	hsa-miR-3150a-3p	CLIP-seq
MIRT1107398	hsa-miR-3175	CLIP-seq
MIRT1107399	hsa-miR-371-5p	CLIP-seq
MIRT1107400	hsa-miR-371b-5p	CLIP-seq
MIRT1107401	hsa-miR-374a	CLIP-seq
MIRT1107402	hsa-miR-374b	CLIP-seq
MIRT1107403	hsa-miR-3907	CLIP-seq
MIRT1107404	hsa-miR-4276	CLIP-seq
MIRT1107405	hsa-miR-4456	CLIP-seq
MIRT1107406	hsa-miR-4695-5p	CLIP-seq
MIRT1107407	hsa-miR-4760-3p	CLIP-seq
MIRT1107408	hsa-miR-491-5p	CLIP-seq
MIRT1107409	hsa-miR-513c	CLIP-seq
MIRT1107410	hsa-miR-514b-5p	CLIP-seq
MIRT1107411	hsa-miR-541	CLIP-seq
MIRT1107412	hsa-miR-654-5p	CLIP-seq
MIRT1107413	hsa-miR-939	CLIP-seq
MIRT2029656	hsa-miR-143	CLIP-seq
MIRT2029657	hsa-miR-1827	CLIP-seq
MIRT2029658	hsa-miR-3919	CLIP-seq
MIRT2029659	hsa-miR-4527	CLIP-seq
MIRT2029660	hsa-miR-4736	CLIP-seq
MIRT2029661	hsa-miR-4756-3p	CLIP-seq
MIRT2029662	hsa-miR-4770	CLIP-seq
MIRT2029663	hsa-miR-940	CLIP-seq
MIRT2260541	hsa-miR-2278	CLIP-seq
MIRT2260542	hsa-miR-4274	CLIP-seq
MIRT2260543	hsa-miR-455-3p	CLIP-seq
MIRT2260544	hsa-miR-4676-5p	CLIP-seq
MIRT2260545	hsa-miR-575	CLIP-seq
MIRT2260546	hsa-miR-615-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002088	Process	Lens development in camera-type eye	TAS	10655141
GO:0003677	Function	DNA binding	TAS	7641850
GO:0005515	Function	Protein binding	IPI	32296183

Other IDs

• MIM: 607377
• HGNC: 14429
• e!Ensembl: ENSG00000163352

Protein

• UniProt ID: Q9Y5L5
• Protein name: Lens epithelial cell protein LEP503
• Protein function: May play a role in lens epithelial cell differentiation.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15221	LEP503	1 → 61	Lens epithelial cell protein LEP503	Family

• Tissue specificity: TISSUE SPECIFICITY: Restricted to lens epithelial cells. {ECO:0000269|PubMed:11376938}.
• Sequence:

  MQPRTQPLAQTLPFFLGGAPRDTGLRVPVIKMGTGWEGFQRTLKEVAYILLCCWCIKELL
  D

• Sequence length: 61

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CLEAR CELL RENAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations